PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | EPS69741.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lentibulariaceae; Genlisea
|
||||||||
Family | MYB | ||||||||
Protein Properties | Length: 248aa MW: 28056.8 Da PI: 10.024 | ||||||||
Description | MYB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 54.9 | 2e-17 | 65 | 111 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 rg WT++Ede l++av+ + g++Wk+Ia+ ++ Rt+ qc +rwqk+l EPS69741.1 65 RGGWTPDEDETLKNAVAAHKGKSWKKIAEFFP-CRTEVQCLHRWQKVL 111 789*****************************.************986 PP | |||||||
2 | Myb_DNA-binding | 63.5 | 4.2e-20 | 117 | 163 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 +g+WT eEde++v+ v+++G+ W+ Ia+ ++ gR +kqc++rw+++l EPS69741.1 117 KGPWTLEEDEKIVEMVAKHGPTKWSVIAKSLP-GRIGKQCRERWHNHL 163 79******************************.*************97 PP | |||||||
3 | Myb_DNA-binding | 52.3 | 1.3e-16 | 169 | 212 | 1 | 46 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 +++W+ eE++ l++a++ +G++ W+ a+ ++ gRt++ +k++w++ EPS69741.1 169 KDAWSLEEELTLLNAHRVHGNK-WAELAKLLP-GRTDNAIKNHWNS 212 689*******************.*********.***********96 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS51294 | 16.685 | 60 | 111 | IPR017930 | Myb domain |
SMART | SM00717 | 2.4E-13 | 64 | 113 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 1.3E-15 | 65 | 111 | IPR001005 | SANT/Myb domain |
SuperFamily | SSF46689 | 3.88E-15 | 66 | 121 | IPR009057 | Homeodomain-like |
Gene3D | G3DSA:1.10.10.60 | 2.1E-21 | 67 | 118 | IPR009057 | Homeodomain-like |
CDD | cd00167 | 1.05E-11 | 68 | 111 | No hit | No description |
PROSITE profile | PS51294 | 31.248 | 112 | 167 | IPR017930 | Myb domain |
SuperFamily | SSF46689 | 1.34E-31 | 114 | 210 | IPR009057 | Homeodomain-like |
SMART | SM00717 | 3.5E-18 | 116 | 165 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 6.0E-19 | 117 | 163 | IPR001005 | SANT/Myb domain |
CDD | cd00167 | 2.43E-15 | 119 | 163 | No hit | No description |
Gene3D | G3DSA:1.10.10.60 | 2.8E-27 | 119 | 166 | IPR009057 | Homeodomain-like |
Gene3D | G3DSA:1.10.10.60 | 1.4E-22 | 167 | 218 | IPR009057 | Homeodomain-like |
SMART | SM00717 | 7.0E-15 | 168 | 216 | IPR001005 | SANT/Myb domain |
PROSITE profile | PS51294 | 20.61 | 168 | 218 | IPR017930 | Myb domain |
Pfam | PF00249 | 7.0E-15 | 169 | 212 | IPR001005 | SANT/Myb domain |
CDD | cd00167 | 2.25E-10 | 171 | 214 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 248 aa Download sequence Send to blast |
LLMDVVESED PYPNQKESAT TLSSSVSENS SDFAAKSPGI SSPASTSPSR SMIERRTTGP 60 IRRARGGWTP DEDETLKNAV AAHKGKSWKK IAEFFPCRTE VQCLHRWQKV LNPELIKGPW 120 TLEEDEKIVE MVAKHGPTKW SVIAKSLPGR IGKQCRERWH NHLNPEIKKD AWSLEEELTL 180 LNAHRVHGNK WAELAKLLPG RTDNAIKNHW NSSLKKKLDF YLVTGNLPQV PRSNTENGNR 240 DNLRRTAP |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1h88_C | 1e-71 | 68 | 218 | 9 | 159 | MYB PROTO-ONCOGENE PROTEIN |
1h89_C | 1e-71 | 68 | 218 | 9 | 159 | MYB PROTO-ONCOGENE PROTEIN |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor that binds 5'-AACGG-3' motifs in gene promoters (By similarity). Transcription repressor that regulates organ growth. Binds to the promoters of G2/M-specific genes and to E2F target genes to prevent their expression in post-mitotic cells and to restrict the time window of their expression in proliferating cells (PubMed:26069325). {ECO:0000250|UniProtKB:Q94FL9, ECO:0000269|PubMed:26069325}. |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Slightly induced by ethylene, auxin (IAA), jasmonic acid (JA) and salicylic acid (SA). {ECO:0000269|PubMed:16463103}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_017418575.1 | 1e-127 | PREDICTED: myb-like protein A | ||||
Refseq | XP_017418576.1 | 1e-127 | PREDICTED: myb-like protein A | ||||
Swissprot | Q8H1P9 | 1e-113 | MB3R3_ARATH; Transcription factor MYB3R-3 | ||||
TrEMBL | S8CXI4 | 0.0 | S8CXI4_9LAMI; Uncharacterized protein (Fragment) | ||||
STRING | AES79331 | 1e-125 | (Medicago truncatula) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Asterids | OGEA5461 | 24 | 37 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G02320.2 | 1e-108 | myb domain protein 3r-5 |
Publications ? help Back to Top | |||
---|---|---|---|
|