PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | EPS69080.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lentibulariaceae; Genlisea
|
||||||||
Family | G2-like | ||||||||
Protein Properties | Length: 193aa MW: 21299.2 Da PI: 6.5136 | ||||||||
Description | G2-like family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | G2-like | 108.8 | 2.8e-34 | 38 | 92 | 1 | 55 |
G2-like 1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 kprlrWt eLH+rFv+av+qLGG+ekAtPkti+++m+vkgLtl+h+kSHLQkYR+ EPS69080.1 38 KPRLRWTAELHDRFVDAVAQLGGPEKATPKTIMRTMGVKGLTLYHLKSHLQKYRM 92 79****************************************************7 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS51294 | 11.7 | 35 | 95 | IPR017930 | Myb domain |
Gene3D | G3DSA:1.10.10.60 | 1.1E-32 | 36 | 93 | IPR009057 | Homeodomain-like |
SuperFamily | SSF46689 | 6.09E-17 | 38 | 92 | IPR009057 | Homeodomain-like |
TIGRFAMs | TIGR01557 | 2.4E-24 | 38 | 92 | IPR006447 | Myb domain, plants |
Pfam | PF00249 | 1.9E-9 | 40 | 91 | IPR001005 | SANT/Myb domain |
Pfam | PF14379 | 1.1E-22 | 126 | 171 | IPR025756 | MYB-CC type transcription factor, LHEQLE-containing domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0010628 | Biological Process | positive regulation of gene expression | ||||
GO:0016036 | Biological Process | cellular response to phosphate starvation | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 193 aa Download sequence Send to blast |
MYSALAIQDL AAEANGGLLD GTNLPGDGCL VLTSSDPKPR LRWTAELHDR FVDAVAQLGG 60 PEKATPKTIM RTMGVKGLTL YHLKSHLQKY RMGRQASKEL TESSKEESHD AGGLSSADAL 120 LNDGYQVTEA LRAQMEVQRR LHQQLQVQRH LDIRLDAQGR YLQSILENAC KLMEDQSALV 180 DVTRNDFSAL AII |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
6j4r_A | 1e-20 | 38 | 94 | 1 | 57 | Protein PHOSPHATE STARVATION RESPONSE 1 |
6j4r_B | 1e-20 | 38 | 94 | 1 | 57 | Protein PHOSPHATE STARVATION RESPONSE 1 |
6j4r_C | 1e-20 | 38 | 94 | 1 | 57 | Protein PHOSPHATE STARVATION RESPONSE 1 |
6j4r_D | 1e-20 | 38 | 94 | 1 | 57 | Protein PHOSPHATE STARVATION RESPONSE 1 |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcriptional activator (PubMed:26586833). Acts redundantly with PHR1 as a key component of the central regulatory system controlling transcriptional responses to Pi starvation (PubMed:26586833). Binds in a sequence-specific manner to phosphate starvation-regulated promoters (PubMed:26586833). {ECO:0000269|PubMed:26586833}. |
Binding Motif ? help Back to Top | |||
---|---|---|---|
Motif ID | Method | Source | Motif file |
MP00378 | DAP | Transfer from AT3G24120 | Download |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Up-regulated in roots by low Pi. {ECO:0000269|PubMed:26586833}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_011091432.1 | 1e-92 | protein PHR1-LIKE 2 isoform X2 | ||||
Swissprot | Q94A57 | 7e-85 | PHL2_ARATH; Protein PHR1-LIKE 2 | ||||
TrEMBL | S8CQP6 | 1e-139 | S8CQP6_9LAMI; Uncharacterized protein (Fragment) | ||||
STRING | XP_002518104.1 | 4e-84 | (Ricinus communis) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Asterids | OGEA3791 | 23 | 44 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT3G24120.1 | 2e-68 | G2-like family protein |
Publications ? help Back to Top | |||
---|---|---|---|
|