PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID EPS68796.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lentibulariaceae; Genlisea
Family GRAS
Protein Properties Length: 468aa    MW: 53206.6 Da    PI: 7.118
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
EPS68796.1genomeLSMUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS263.48e-811044682374
        GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlar.svselykalppsetsekn.sseelaalklfsevsPilkfshlta 98 
                 ++lL +cA+a+ ++d  ++++lL+ l+el+sp+gd  ++la yf++A   + ++  + e+     + ++++ +  ++++     f+evsP+l+f+h++ 
  EPS68796.1 104 EQLLRDCATAIVEKDSIRIRRLLWLLNELSSPYGDCEEKLAYYFMQAFLFHSTGfFGRETL---LTAAAEKAHcFDSVVGLILKFQEVSPWLTFGHVAS 199
                 58999******************************************98888873333333...22222222224444444445*************** PP

        GRAS  99 NqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesgskeeleetgerLakfAeelgvpfefnvlvakrledleleeLrvk 197
                 N aIlea+ege+++H++D++ + ++QWp++l+aLa+R +++p+++iT+v+   +  + +   ++ r+++fA+ +gvpfef+v+       ++ ++L+v+
  EPS68796.1 200 NGAILEAMEGERKIHVLDMSNTLCTQWPTFLEALATRCGDAPEVKITVVALTPAITSVMNVDIAPRMRRFARLMGVPFEFDVI----DGLMNKDSLKVR 294
                 ***************************************************76669999999********************7....5678899***** PP

        GRAS 198 pgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadh..nsesFlerflealeyysalfdsleaklpreseerikvErellgrei 294
                 ++Eal+Vn++ +l  l      l++ r+ +++++ksl Pkvv+ ve+e+d   ++ +++erf  ++++y+  +d+le  +p++see+  +Ere  +r i
  EPS68796.1 295 NDEALIVNCIGALRGLE-----LDE-RKPLIRTIKSLAPKVVTAVEEELDFssSKRNLVERFEGCFRFYTLYLDMLEDCFPATSEEKLILERE-CSRTI 386
                 *************9997.....444.789*******************998545569************************************.89*** PP

        GRAS 295 vnvvacegae...rrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsvSaWr 374
                 + +v+   +     ++++e+  +W+  ++++GF+++++s+++++++k+l++k+   g+++ +es  ++l+Wkd+p+v+ S+W+
  EPS68796.1 387 MRLVCRDDRVgegETKKEENEVHWSGLFRDSGFSTIAYSTDVMDDVKALIKKHR-SGWSMVCESWGMYLTWKDEPVVWSSSWK 468
                 ****986443222678888889*******************************9.99*************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0103612.0E-27162IPR002675Ribosomal protein L38e
PfamPF017812.8E-30264IPR002675Ribosomal protein L38e
PROSITE profilePS5098537.99677449IPR005202Transcription factor GRAS
PfamPF035142.8E-78104468IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0006412Biological Processtranslation
GO:0005840Cellular Componentribosome
GO:0003735Molecular Functionstructural constituent of ribosome
Sequence ? help Back to Top
Protein Sequence    Length: 468 aa     Download sequence    Send to blast
MPKQIHEIKD FLLTARRKDA RSVKIKRSKD VVKFKVRCSK YLYTLCVFDP EKADKLKQSL  60
PPDKQQLPLP IPMEGGGGAS IKQCTLLHQP QSGATPSDGP KWSEQLLRDC ATAIVEKDSI  120
RIRRLLWLLN ELSSPYGDCE EKLAYYFMQA FLFHSTGFFG RETLLTAAAE KAHCFDSVVG  180
LILKFQEVSP WLTFGHVASN GAILEAMEGE RKIHVLDMSN TLCTQWPTFL EALATRCGDA  240
PEVKITVVAL TPAITSVMNV DIAPRMRRFA RLMGVPFEFD VIDGLMNKDS LKVRNDEALI  300
VNCIGALRGL ELDERKPLIR TIKSLAPKVV TAVEEELDFS SSKRNLVERF EGCFRFYTLY  360
LDMLEDCFPA TSEEKLILER ECSRTIMRLV CRDDRVGEGE TKKEENEVHW SGLFRDSGFS  420
TIAYSTDVMD DVKALIKKHR SGWSMVCESW GMYLTWKDEP VVWSSSWK
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5b3g_B1e-1039746881473Protein SHORT-ROOT
5b3h_B1e-1039746827419Protein SHORT-ROOT
5b3h_E1e-1039746827419Protein SHORT-ROOT
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011073835.11e-153protein SHORT-ROOT
TrEMBLS8CV720.0S8CV72_9LAMI; Uncharacterized protein
STRINGXP_009786324.11e-146(Nicotiana sylvestris)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA20312464
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G37650.11e-105GRAS family protein
Publications ? help Back to Top
  1. Leushkin EV, et al.
    The miniature genome of a carnivorous plant Genlisea aurea contains a low number of genes and short non-coding sequences.
    BMC Genomics, 2013. 14: p. 476
    [PMID:23855885]