PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | EPS68758.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lentibulariaceae; Genlisea
|
||||||||
Family | MYB | ||||||||
Protein Properties | Length: 116aa MW: 13533.8 Da PI: 10.7247 | ||||||||
Description | MYB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 49.2 | 1.2e-15 | 14 | 61 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 rg+WT eEd +lvd + G ++W+ +++ g+ R++k+c++rw +yl EPS68758.1 14 RGSWTSEEDSKLVDFILNNGIPSWRMVPKLAGLMRCGKSCRLRWMNYL 61 89********************************************97 PP | |||||||
2 | Myb_DNA-binding | 51.3 | 2.7e-16 | 67 | 110 | 1 | 46 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 rg +T E++ +++++ +lG++ W++Ia++++ gRt++++k+ w++ EPS68758.1 67 RGGFTDAEEDMIIQLHSKLGNR-WSKIASHFP-GRTDNEIKNQWNT 110 788*******************.*********.***********97 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS51294 | 13.917 | 9 | 61 | IPR017930 | Myb domain |
SuperFamily | SSF46689 | 5.24E-29 | 11 | 108 | IPR009057 | Homeodomain-like |
SMART | SM00717 | 1.2E-7 | 13 | 63 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 4.6E-12 | 14 | 61 | IPR001005 | SANT/Myb domain |
Gene3D | G3DSA:1.10.10.60 | 7.9E-21 | 15 | 68 | IPR009057 | Homeodomain-like |
CDD | cd00167 | 7.69E-7 | 16 | 61 | No hit | No description |
PROSITE profile | PS51294 | 24.741 | 62 | 116 | IPR017930 | Myb domain |
SMART | SM00717 | 6.3E-16 | 66 | 114 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 6.6E-15 | 67 | 110 | IPR001005 | SANT/Myb domain |
Gene3D | G3DSA:1.10.10.60 | 7.1E-27 | 69 | 116 | IPR009057 | Homeodomain-like |
CDD | cd00167 | 3.35E-11 | 70 | 110 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 116 aa Download sequence Send to blast |
MGRQPCCEKV GLRRGSWTSE EDSKLVDFIL NNGIPSWRMV PKLAGLMRCG KSCRLRWMNY 60 LRPDLKRGGF TDAEEDMIIQ LHSKLGNRWS KIASHFPGRT DNEIKNQWNT RIKKKL |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1a5j_A | 4e-29 | 12 | 116 | 5 | 108 | B-MYB |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Possible transcription activator. | |||||
UniProt | Transcription factor that acts as positive regulator of abscisic acid (ABA) signaling in response to salt stress. Acts as negative regulator ABI1, ABI2 and PP2CA, which are protein phosphatases 2C acting as negative regulator of ABA signaling. Binds to the DNA specific sequence and core element 5'-ACGT-3' found in the promoters of ABI1 and PP2CA to negatively regulate their expression during ABA-dependent salt stress response. {ECO:0000269|PubMed:23660402}. |
Binding Motif ? help Back to Top | |||
---|---|---|---|
Motif ID | Method | Source | Motif file |
MP00510 | DAP | Transfer from AT5G14340 | Download |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Induced by salt stress, drought stress and abscisic acid (ABA). Down-regulated by salicylic acid (SA) methyl jasmonate (JA). {ECO:0000269|PubMed:23660402}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | Retrieve |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_011071180.1 | 5e-71 | protein ODORANT1 | ||||
Swissprot | P80073 | 3e-61 | MYB2_PHYPA; Myb-related protein Pp2 | ||||
Swissprot | Q9C7U7 | 2e-62 | MYB20_ARATH; Transcription factor MYB20 | ||||
TrEMBL | S8DZI2 | 1e-80 | S8DZI2_9LAMI; Uncharacterized protein (Fragment) | ||||
STRING | cassava4.1_028453m | 4e-69 | (Manihot esculenta) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Asterids | OGEA12 | 24 | 2154 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G14340.1 | 1e-69 | myb domain protein 40 |
Publications ? help Back to Top | |||
---|---|---|---|
|