PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID EPS67877.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lentibulariaceae; Genlisea
Family GRAS
Protein Properties Length: 450aa    MW: 50657 Da    PI: 6.9155
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
EPS67877.1genomeLSMUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS444.28.8e-136364461373
        GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfshltaN 99 
                 l++lL++cA++v+sg+le+a+ +L ++s+lasp+gd+mqR+a+yf eALa r++r+++++ ka+++++ s    ++e++++k+f+e  P+ k++++++N
  EPS67877.1  36 LIHLLVTCANHVASGNLENANIALDQISHLASPEGDTMQRIASYFSEALADRILRTWPGVHKAFRSTRIS--VAADEIMVRKMFFEFLPFTKVAFVITN 132
                 689************************************************************9988887..699************************ PP

        GRAS 100 qaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesgskeeleetgerLakfAeelgvpfefnvlvakrledleleeLrvkp 198
                 qaI ea+ege++vH+iD++  +++QW +L++ L++Rpegpp+lRiT++++    +ke le++++ L++ Ae+l++pf+f + ++++le+l++e+Lrvk+
  EPS67877.1 133 QAIIEAMEGEKMVHVIDLNGAEPVQWCTLIRDLSARPEGPPHLRITAIHH----HKEVLEQMAQVLTEEAEKLDIPFQFIP-IVSKLENLDIEKLRVKT 226
                 **************************************************....9**************************.7999************* PP

        GRAS 199 gEalaVnlvlqlhrll.............................................desvsleserdevLklvkslsPkvvvvveqeadhnses 252
                 gEala+++v + h+ll                                             +++ + +s++d +L+++++lsPkv+vv+eq++dhn++s
  EPS67877.1 227 GEALAISSVTKFHELLasvnrpssstaishhlqrvimpvnssspvednanpfspcgnnntaSSPPQPSSRIDGFLNALWGLSPKVMVVTEQDSDHNGKS 325
                 *********************************************************99955555555599**************************** PP

        GRAS 253 FlerflealeyysalfdsleaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrv 351
                 ++er++e+l++ysalfd+le+ lp++s er+k+E++llg+ei+n+++cegaer++rhe+le+W +r+++aGF++ +ls+++  qak+ll+ ++ dgy++
  EPS67877.1 326 LMERLSESLYFYSALFDCLESALPKTSLERSKMEKMLLGEEIKNIISCEGAERKHRHEKLENWCKRFQSAGFTKFSLSYYTLLQAKRLLQSFNCDGYKI 424
                 *************************************************************************************************** PP

        GRAS 352 eeesgslvlgWkdrpLvsvSaW 373
                 +ee+g++ ++W drpL+svSaW
  EPS67877.1 425 KEENGCASIYWYDRPLFSVSAW 446
                 ********************** PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098555.71410427IPR005202Transcription factor GRAS
PfamPF035143.1E-13336446IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009739Biological Processresponse to gibberellin
GO:0005634Cellular Componentnucleus
Sequence ? help Back to Top
Protein Sequence    Length: 450 aa     Download sequence    Send to blast
SSSVTSSPVQ VFPLMSLSPS YPWLKDLKPE DRGLYLIHLL VTCANHVASG NLENANIALD  60
QISHLASPEG DTMQRIASYF SEALADRILR TWPGVHKAFR STRISVAADE IMVRKMFFEF  120
LPFTKVAFVI TNQAIIEAME GEKMVHVIDL NGAEPVQWCT LIRDLSARPE GPPHLRITAI  180
HHHKEVLEQM AQVLTEEAEK LDIPFQFIPI VSKLENLDIE KLRVKTGEAL AISSVTKFHE  240
LLASVNRPSS STAISHHLQR VIMPVNSSSP VEDNANPFSP CGNNNTASSP PQPSSRIDGF  300
LNALWGLSPK VMVVTEQDSD HNGKSLMERL SESLYFYSAL FDCLESALPK TSLERSKMEK  360
MLLGEEIKNI ISCEGAERKH RHEKLENWCK RFQSAGFTKF SLSYYTLLQA KRLLQSFNCD  420
GYKIKEENGC ASIYWYDRPL FSVSAWSSRR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5b3h_A2e-69244496380Protein SCARECROW
5b3h_D2e-69244496380Protein SCARECROW
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor involved in plant development. {ECO:0000250}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011080382.10.0scarecrow-like protein 3
SwissprotQ9LPR80.0SCL3_ARATH; Scarecrow-like protein 3
TrEMBLS8E6860.0S8E686_9LAMI; Uncharacterized protein (Fragment)
STRINGMigut.D00643.1.p0.0(Erythranthe guttata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA29142453
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G50420.10.0scarecrow-like 3
Publications ? help Back to Top
  1. Leushkin EV, et al.
    The miniature genome of a carnivorous plant Genlisea aurea contains a low number of genes and short non-coding sequences.
    BMC Genomics, 2013. 14: p. 476
    [PMID:23855885]
  2. Gong X, et al.
    SEUSS Integrates Gibberellin Signaling with Transcriptional Inputs from the SHR-SCR-SCL3 Module to Regulate Middle Cortex Formation in the Arabidopsis Root.
    Plant Physiol., 2016. 170(3): p. 1675-83
    [PMID:26818732]
  3. Lee SA, et al.
    Interplay between ABA and GA Modulates the Timing of Asymmetric Cell Divisions in the Arabidopsis Root Ground Tissue.
    Mol Plant, 2016. 9(6): p. 870-84
    [PMID:26970019]
  4. Choi JW,Lim J
    Control of Asymmetric Cell Divisions during Root Ground Tissue Maturation.
    Mol. Cells, 2016. 39(7): p. 524-9
    [PMID:27306644]