PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | EPS67436.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lentibulariaceae; Genlisea
|
||||||||
Family | MYB | ||||||||
Protein Properties | Length: 118aa MW: 13954 Da PI: 11.2843 | ||||||||
Description | MYB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 48.1 | 2.7e-15 | 12 | 58 | 1 | 47 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 rg W + Ed l+++v+ +G+ +W++Ia++++ +R++k+c++rw++ EPS67436.1 12 RGHWRPSEDFELKQLVAVYGPQNWNLIAQKLQGRRSGKSCRLRWFNQ 58 899*****************************9***********996 PP | |||||||
2 | Myb_DNA-binding | 56.6 | 5.7e-18 | 65 | 107 | 1 | 45 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 r ++++eE+e+l a++++G++ W+ Iar ++ gRt++ +k++w+ EPS67436.1 65 RRAFSEEEEERLMAAHRLYGNK-WAMIARLFP-GRTDNAVKNHWH 107 678*******************.*********.***********7 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS51294 | 15.6 | 7 | 59 | IPR017930 | Myb domain |
SMART | SM00717 | 6.6E-12 | 11 | 61 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 7.2E-15 | 12 | 58 | IPR001005 | SANT/Myb domain |
SuperFamily | SSF46689 | 2.4E-27 | 12 | 106 | IPR009057 | Homeodomain-like |
Gene3D | G3DSA:1.10.10.60 | 7.1E-24 | 13 | 66 | IPR009057 | Homeodomain-like |
CDD | cd00167 | 1.04E-9 | 15 | 57 | No hit | No description |
PROSITE profile | PS51294 | 27.032 | 60 | 114 | IPR017930 | Myb domain |
SMART | SM00717 | 6.4E-14 | 64 | 112 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 1.3E-14 | 65 | 107 | IPR001005 | SANT/Myb domain |
CDD | cd00167 | 3.61E-10 | 67 | 107 | No hit | No description |
Gene3D | G3DSA:1.10.10.60 | 3.4E-21 | 67 | 113 | IPR009057 | Homeodomain-like |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 118 aa Download sequence Send to blast |
GSGSLRSKIC SRGHWRPSED FELKQLVAVY GPQNWNLIAQ KLQGRRSGKS CRLRWFNQLD 60 PRINRRAFSE EEEERLMAAH RLYGNKWAMI ARLFPGRTDN AVKNHWHIVM ARKYRETS |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1a5j_A | 2e-31 | 12 | 113 | 7 | 107 | B-MYB |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Probable transcription factor that involved in boundary specification, meristem initiation and maintenance, and organ patterning. Functions in both lateral organ separation and axillary meristem formation. {ECO:0000269|PubMed:19542355}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | NP_001307310.1 | 2e-69 | transcription factor MYB117 | ||||
Refseq | XP_016571686.1 | 2e-69 | PREDICTED: uncharacterized protein LOC107869748 | ||||
Swissprot | Q9SEZ4 | 4e-67 | MY105_ARATH; Transcription factor MYB105 | ||||
TrEMBL | S8CRG1 | 8e-83 | S8CRG1_9LAMI; Uncharacterized protein (Fragment) | ||||
STRING | ERM94527 | 6e-69 | (Amborella trichopoda) | ||||
STRING | Solyc05g007870.1.1 | 7e-69 | (Solanum lycopersicum) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Asterids | OGEA1684 | 24 | 70 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G69560.1 | 2e-69 | myb domain protein 105 |
Publications ? help Back to Top | |||
---|---|---|---|
|