PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | EPS66220.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lentibulariaceae; Genlisea
|
||||||||
Family | NF-YC | ||||||||
Protein Properties | Length: 119aa MW: 13395.5 Da PI: 9.5561 | ||||||||
Description | NF-YC family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NF-YC | 62.4 | 8.7e-20 | 6 | 86 | 18 | 98 |
NF-YC 18 nhelPlarikkilkadedvkmisaeaPvllskacelfileltlrswlhaeenkrrtlkksdiaaavtrtdifdflvdivpr 98 ++++P arikki++adedv +i+ +Pvl+ska elf+ +l r++ + + +t+ ++++v++ ++fdfl +iv + EPS66220.1 6 DTRFPAARIKKIMQADEDVGKIAMAVPVLVSKALELFLQDLCDRTYDVTLRKGAKTVTSLHLKQCVQSYNVFDFLKEIVSK 86 5789*************************************************************************9976 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:1.10.20.10 | 2.8E-27 | 3 | 72 | IPR009072 | Histone-fold |
SuperFamily | SSF47113 | 2.99E-22 | 4 | 93 | IPR009072 | Histone-fold |
Pfam | PF00808 | 7.1E-20 | 8 | 71 | IPR003958 | Transcription factor CBF/NF-Y/archaeal histone domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0046982 | Molecular Function | protein heterodimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 119 aa Download sequence Send to blast |
MRKKLDTRFP AARIKKIMQA DEDVGKIAMA VPVLVSKALE LFLQDLCDRT YDVTLRKGAK 60 TVTSLHLKQC VQSYNVFDFL KEIVSKVPDF TTSEGAAESL KKRKLAANES NDSDDESKR |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1jfi_A | 4e-25 | 2 | 72 | 5 | 75 | Transcription Regulator NC2 alpha chain |
Search in ModeBase |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_020553014.1 | 3e-67 | dr1-associated corepressor-like isoform X2 | ||||
Swissprot | Q14919 | 6e-31 | NC2A_HUMAN; Dr1-associated corepressor | ||||
TrEMBL | S8CH80 | 5e-81 | S8CH80_9LAMI; Uncharacterized protein (Fragment) | ||||
STRING | XP_009780056.1 | 4e-65 | (Nicotiana sylvestris) | ||||
STRING | XP_009618301.1 | 3e-65 | (Nicotiana tomentosiformis) | ||||
STRING | Migut.N01867.1.p | 4e-65 | (Erythranthe guttata) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Asterids | OGEA7960 | 22 | 30 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT3G12480.1 | 2e-61 | nuclear factor Y, subunit C11 |
Publications ? help Back to Top | |||
---|---|---|---|
|