PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | EPS65704.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lentibulariaceae; Genlisea
|
||||||||
Family | NAC | ||||||||
Protein Properties | Length: 224aa MW: 25155.2 Da PI: 7.5415 | ||||||||
Description | NAC family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NAM | 166.7 | 7.7e-52 | 23 | 150 | 1 | 128 |
NAM 1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp..kkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskkg 97 l+pGfrFhPtdeelv +yL++k+ +k++++ ++++e+d+yk+ePw+L +++k+++ ewyfFs+ d+ky +g+r nrat +gyWkatgkd++v + k+ EPS65704.1 23 LAPGFRFHPTDEELVRYYLRRKACAKPFRF-QAVAEIDVYKSEPWELAdhSSLKSRDLEWYFFSPVDRKYGNGSRLNRATGKGYWKATGKDRAVRH-KN 119 579*************************99.88**************84347777888**************************************.88 PP NAM 98 elvglkktLvfykgrapkgektdWvmheyrl 128 ++g+kktLvf++grap+g++t+Wvmheyrl EPS65704.1 120 LTIGMKKTLVFHSGRAPDGKRTNWVMHEYRL 150 99***************************98 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SuperFamily | SSF101941 | 2.09E-62 | 16 | 173 | IPR003441 | NAC domain |
PROSITE profile | PS51005 | 57.118 | 23 | 173 | IPR003441 | NAC domain |
Pfam | PF02365 | 1.2E-28 | 25 | 150 | IPR003441 | NAC domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0009555 | Biological Process | pollen development | ||||
GO:0010228 | Biological Process | vegetative to reproductive phase transition of meristem | ||||
GO:0005730 | Cellular Component | nucleolus | ||||
GO:0003677 | Molecular Function | DNA binding | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 224 aa Download sequence Send to blast |
VVGGANTAPQ PAVGSVAPPA TSLAPGFRFH PTDEELVRYY LRRKACAKPF RFQAVAEIDV 60 YKSEPWELAD HSSLKSRDLE WYFFSPVDRK YGNGSRLNRA TGKGYWKATG KDRAVRHKNL 120 TIGMKKTLVF HSGRAPDGKR TNWVMHEYRL CDSDLEKAGV AQDAFVLCRI FQKSGLGPPN 180 GDRYAPFVEE EWDYEEEAAL MVPGGDGEDE MANGDECPRL HQRS |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1ut4_A | 3e-53 | 22 | 173 | 16 | 165 | NO APICAL MERISTEM PROTEIN |
1ut4_B | 3e-53 | 22 | 173 | 16 | 165 | NO APICAL MERISTEM PROTEIN |
1ut7_A | 3e-53 | 22 | 173 | 16 | 165 | NO APICAL MERISTEM PROTEIN |
1ut7_B | 3e-53 | 22 | 173 | 16 | 165 | NO APICAL MERISTEM PROTEIN |
3swm_A | 3e-53 | 22 | 173 | 19 | 168 | NAC domain-containing protein 19 |
3swm_B | 3e-53 | 22 | 173 | 19 | 168 | NAC domain-containing protein 19 |
3swm_C | 3e-53 | 22 | 173 | 19 | 168 | NAC domain-containing protein 19 |
3swm_D | 3e-53 | 22 | 173 | 19 | 168 | NAC domain-containing protein 19 |
3swp_A | 3e-53 | 22 | 173 | 19 | 168 | NAC domain-containing protein 19 |
3swp_B | 3e-53 | 22 | 173 | 19 | 168 | NAC domain-containing protein 19 |
3swp_C | 3e-53 | 22 | 173 | 19 | 168 | NAC domain-containing protein 19 |
3swp_D | 3e-53 | 22 | 173 | 19 | 168 | NAC domain-containing protein 19 |
4dul_A | 3e-53 | 22 | 173 | 16 | 165 | NAC domain-containing protein 19 |
4dul_B | 3e-53 | 22 | 173 | 16 | 165 | NAC domain-containing protein 19 |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcriptional activator activated by proteolytic cleavage through regulated intramembrane proteolysis (RIP) (By similarity). Transcripition activator associated with the induction of genes related to flavonoid biosynthesis and required for the accumulation of anthocyanins in response to high light stress (PubMed:19887540). Plays a role in the regulation of 20S and 26S proteasomes in response to high light stress (PubMed:21889048). {ECO:0000250|UniProtKB:Q949N0, ECO:0000269|PubMed:19887540, ECO:0000269|PubMed:21889048}. | |||||
UniProt | Transcriptional repressor that binds to the motif 5'-(C/T)A(C/A)G-3' in the promoter of target genes (PubMed:25578968). Binds also to the 5'-CTTGNNNNNCAAG-3' consensus sequence in chromatin (PubMed:26617990). Can bind to the mitochondrial dysfunction motif (MDM) present in the upstream regions of mitochondrial dysfunction stimulon (MDS) genes involved in mitochondrial retrograde regulation (MRR) (PubMed:24045019). Together with NAC050 and JMJ14, regulates gene expression and flowering time by associating with the histone demethylase JMJ14, probably by the promotion of RNA-mediated gene silencing (PubMed:25578968, PubMed:26617990). Regulates siRNA-dependent post-transcriptional gene silencing (PTGS) through SGS3 expression modulation (PubMed:28207953). Required during pollen development (PubMed:19237690). {ECO:0000269|PubMed:19237690, ECO:0000269|PubMed:24045019, ECO:0000269|PubMed:25578968, ECO:0000269|PubMed:26617990, ECO:0000269|PubMed:28207953}. |
Binding Motif ? help Back to Top | |||
---|---|---|---|
Motif ID | Method | Source | Motif file |
MP00612 | ChIP-seq | Transfer from AT3G10490 | Download |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: By exposure to high light (PubMed:19887540). Induced by heat and methyl methanesulfonate (MMS) treatment (PubMed:17158162). {ECO:0000269|PubMed:17158162, ECO:0000269|PubMed:19887540}. | |||||
UniProt | INDUCTION: Induced by type III effector proteins (TTEs) secreted by the pathogenic bacteria P.syringae pv. tomato DC3000 during basal defense. {ECO:0000269|PubMed:16553893}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | Retrieve |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_011076898.1 | 1e-135 | NAC domain-containing protein 78-like | ||||
Swissprot | Q84K00 | 1e-92 | NAC78_ARATH; NAC domain-containing protein 78 | ||||
Swissprot | Q9SQY0 | 4e-93 | NAC52_ARATH; NAC domain containing protein 52 | ||||
TrEMBL | S8CFK6 | 1e-167 | S8CFK6_9LAMI; Nam-like protein 4 (Fragment) | ||||
STRING | XP_009780872.1 | 1e-131 | (Nicotiana sylvestris) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Asterids | OGEA3140 | 24 | 48 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT3G10490.1 | 9e-92 | NAC domain containing protein 52 |