PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

EPS64893.1

Organism

Genlisea aurea

Taxonomic ID

192259

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lentibulariaceae; Genlisea

Family

G2-like

Protein Properties

Length: 78aa MW: 8500.94 Da PI: 10.4811

Description

G2-like family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
EPS64893.1	genome	LSMU	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	G2-like	100.1	1.5e-31	28	78	1	51
G2-like 1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQ 51 kprlrWt eLHerFv+av+qLGG++kAtPkti+++m+vkgLtl+h+kSHLQ EPS64893.1 28 KPRLRWTGELHERFVDAVTQLGGPDKATPKTIMRVMGVKGLTLYHLKSHLQ 78 79************************************************9 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
Gene3D	G3DSA:1.10.10.60	6.1E-30	25	78	IPR009057	Homeodomain-like
PROSITE profile	PS51294	11.737	25	78	IPR017930	Myb domain
SuperFamily	SSF46689	3.4E-15	27	78	IPR009057	Homeodomain-like
TIGRFAMs	TIGR01557	5.2E-22	28	78	IPR006447	Myb domain, plants
Pfam	PF00249	2.1E-7	30	78	IPR001005	SANT/Myb domain

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0005634	Cellular Component	nucleus
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 78 aa Download sequence Send to blast
KKPSPATGPA GVERPICDSG LVLTTDPKPR LRWTGELHER FVDAVTQLGG PDKATPKTIM 60 RVMGVKGLTL YHLKSHLQ

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
6j4r_A	1e-19	28	78	1	51	Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_B	1e-19	28	78	1	51	Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_C	1e-19	28	78	1	51	Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_D	1e-19	28	78	1	51	Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Transcription factor required for phloem identity. Has a dual role both in promoting phloem differentiation and in repressing xylem differentiation during vascular development. Regulates the expression of the transcription factor NAC045 (AC A4VCM0). May activate the transcription of specific genes involved in phosphate uptake or assimilation (PubMed:15592750). Promotes flowering through transcriptional activation of both FT and its transport machinery component, FTIP1 (PubMed:26239308). {ECO:0000269\|PubMed:14614507, ECO:0000269\|PubMed:18523061, ECO:0000269\|PubMed:25081480, ECO:0000269\|PubMed:26239308, ECO:0000305\|PubMed:15592750}.

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: Up-regulated by phosphate deficiency. {ECO:0000269\|PubMed:15592750}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_022545127.1	1e-37	myb family transcription factor APL-like
Refseq	XP_022947346.1	3e-37	myb family transcription factor APL
Refseq	XP_023533836.1	3e-37	myb family transcription factor APL
Swissprot	Q9SAK5	1e-36	APL_ARATH; Myb family transcription factor APL
TrEMBL	S8DPE9	9e-50	S8DPE9_9LAMI; Uncharacterized protein (Fragment)
STRING	cassava4.1_025222m	2e-37	(Manihot esculenta)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Asterids	OGEA12062	16	23

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT1G79430.2	5e-39	G2-like family protein

Publications ? help Back to Top
Leushkin EV, et al. The miniature genome of a carnivorous plant Genlisea aurea contains a low number of genes and short non-coding sequences. BMC Genomics, 2013. 14: p. 476 [PMID:23855885] Martínez-Navarro AC,Galván-Gordillo SV,Xoconostle-Cázares B,Ruiz-Medrano R Vascular gene expression: a hypothesis. Front Plant Sci, 2013. 4: p. 261 [PMID:23882276] Ding Y, et al. Four distinct types of dehydration stress memory genes in Arabidopsis thaliana. BMC Plant Biol., 2013. 13: p. 229 [PMID:24377444] Kondo Y, et al. Vascular Cell Induction Culture System Using Arabidopsis Leaves (VISUAL) Reveals the Sequential Differentiation of Sieve Element-Like Cells. Plant Cell, 2016. 28(6): p. 1250-62 [PMID:27194709] Shibuta M,Abe M FE Controls the Transcription of Downstream Flowering Regulators Through Two Distinct Mechanisms in Leaf Phloem Companion Cells. Plant Cell Physiol., 2017. 58(11): p. 2017-2025 [PMID:29036620]