PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Home  TFext  BLAST  Prediction  Download  Help  About  Links  PlantRegMap
(e.g., LFY)
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID EPS64313.1
Organism
Genlisea aurea
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lentibulariaceae; Genlisea
Family SBP
Protein Properties Length: 89aa    MW: 10574.2 Da    PI: 10.6852
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
EPS64313.1genomeLSMUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP123.41e-381388277
                -SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S-- CS
         SBP  2 CqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkq 77
                C v+gC+adl  ++eyhrrh+vCe hskapvv++ ++e+rfCqqCsrfh+lsefD++krsCr+rL+ hn+rrrk q
  EPS64313.1 13 CLVDGCAADLRLCREYHRRHRVCEPHSKAPVVTICNREHRFCQQCSRFHSLSEFDDGKRSCRKRLDWHNKRRRKMQ 88
                **************************************************************************87 PP
Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5114129.8721087IPR004333Transcription factor, SBP-box
Gene3DG3DSA:4.10.1100.107.8E-311074IPR004333Transcription factor, SBP-box
SuperFamilySSF1036121.11E-341188IPR004333Transcription factor, SBP-box
PfamPF031102.2E-291386IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 89 aa     Download sequence    Send to blast
SKRAKVVGGL VQCLVDGCAA DLRLCREYHR RHRVCEPHSK APVVTICNRE HRFCQQCSRF  60
HSLSEFDDGK RSCRKRLDWH NKRRRKMQP
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A6e-27986784squamosa promoter binding protein-like 4
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTrans-acting factor that binds specifically to the consensus nucleotide sequence 5'-TNCGTACAA-3'. {ECO:0000250}.
UniProtTrans-acting factor that binds specifically to the consensus nucleotide sequence 5'-TNCGTACAA-3'. {ECO:0000250}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Negatively regulated by microRNAs miR156 and miR157. {ECO:0000305|PubMed:12202040}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004239238.16e-40teosinte glume architecture 1
RefseqXP_004239239.16e-40teosinte glume architecture 1
RefseqXP_010321017.16e-40teosinte glume architecture 1
RefseqXP_010321018.16e-40teosinte glume architecture 1
RefseqXP_015074805.16e-40teosinte glume architecture 1-like
RefseqXP_015074806.16e-40teosinte glume architecture 1-like
RefseqXP_022885332.16e-40teosinte glume architecture 1-like
RefseqXP_022885337.16e-40teosinte glume architecture 1-like
RefseqXP_022885345.16e-40teosinte glume architecture 1-like
RefseqXP_022885354.16e-40teosinte glume architecture 1-like
RefseqXP_022885362.16e-40teosinte glume architecture 1-like
RefseqXP_022885372.16e-40teosinte glume architecture 1-like
RefseqXP_022885384.16e-40teosinte glume architecture 1-like
RefseqXP_027772616.16e-40teosinte glume architecture 1-like
RefseqXP_027772617.16e-40teosinte glume architecture 1-like
RefseqXP_027772619.16e-40teosinte glume architecture 1-like
SwissprotB9DI208e-35SP13A_ARATH; Squamosa promoter-binding-like protein 13A
SwissprotP0DI118e-35SP13B_ARATH; Squamosa promoter-binding-like protein 13B
TrEMBLS8DMT43e-58S8DMT4_9LAMI; Uncharacterized protein (Fragment)
STRINGSolyc05g015840.2.12e-39(Solanum lycopersicum)
STRINGPGSC0003DMT4000563743e-39(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA49202037
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G50670.13e-37SBP family protein
Publications ? help Back to Top
  1. Leushkin EV, et al.
    The miniature genome of a carnivorous plant Genlisea aurea contains a low number of genes and short non-coding sequences.
    BMC Genomics, 2013. 14: p. 476
    [PMID:23855885]
  2. Jorgensen SA,Preston JC
    Differential SPL gene expression patterns reveal candidate genes underlying flowering time and architectural differences in Mimulus and Arabidopsis.
    Mol. Phylogenet. Evol., 2014. 73: p. 129-39
    [PMID:24508602]
  3. Xu M, et al.
    Developmental Functions of miR156-Regulated SQUAMOSA PROMOTER BINDING PROTEIN-LIKE (SPL) Genes in Arabidopsis thaliana.
    PLoS Genet., 2016. 12(8): p. e1006263
    [PMID:27541584]