PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | EPS64309.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lentibulariaceae; Genlisea
|
||||||||
Family | GRF | ||||||||
Protein Properties | Length: 158aa MW: 17804.2 Da PI: 10.2096 | ||||||||
Description | GRF family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | WRC | 80.7 | 1.3e-25 | 77 | 120 | 1 | 44 |
WRC 1 daepgrCrRtDGKkWRCsrrvlegkklCErHlhrgrsrsrkske 44 d+epgrCrRtDGKkWRCs+++++++k+CErH+hrgr+rsrk++e EPS64309.1 77 DPEPGRCRRTDGKKWRCSKEAYPDSKYCERHMHRGRNRSRKPVE 120 79***************************************986 PP | |||||||
2 | QLQ | 60 | 6.6e-21 | 11 | 45 | 2 | 36 |
QLQ 2 aFTaaQlqlLksQilAyKyLaanqPvPpeLlqaiq 36 +FTa+Q+q+L++Q+l+yKy++++ P+Pp+Ll+ i+ EPS64309.1 11 PFTASQWQELEHQALVYKYMISGIPIPPDLLFTIR 45 9******************************9987 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SMART | SM00951 | 1.3E-11 | 10 | 46 | IPR014978 | Glutamine-Leucine-Glutamine, QLQ |
Pfam | PF08880 | 2.2E-15 | 11 | 45 | IPR014978 | Glutamine-Leucine-Glutamine, QLQ |
PROSITE profile | PS51666 | 21.849 | 11 | 46 | IPR014978 | Glutamine-Leucine-Glutamine, QLQ |
PROSITE profile | PS51667 | 24.941 | 77 | 121 | IPR014977 | WRC domain |
Pfam | PF08879 | 8.9E-22 | 78 | 120 | IPR014977 | WRC domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0009739 | Biological Process | response to gibberellin | ||||
GO:0030912 | Biological Process | response to deep water | ||||
GO:0048366 | Biological Process | leaf development | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0005524 | Molecular Function | ATP binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 158 aa Download sequence Send to blast |
GGGGGGRSRY PFTASQWQEL EHQALVYKYM ISGIPIPPDL LFTIRRSLDS STFLLPQPQQ 60 IGWSGFHMGM GFGRKIDPEP GRCRRTDGKK WRCSKEAYPD SKYCERHMHR GRNRSRKPVE 120 ILSPTPPTTD AIHFTNKTPP ASPPIYLTSS TPASEPNF |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription activator that plays a role in the regulation of cell expansion in leaf and cotyledons tissues. Acts together with GIF1 for the development of appropriate leaf size and shape through the promotion and/or maintenance of cell proliferation activity in leaf primordia. {ECO:0000269|PubMed:15326298, ECO:0000269|PubMed:15960617}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_010047491.1 | 1e-66 | PREDICTED: growth-regulating factor 1 isoform X1 | ||||
Refseq | XP_010047492.1 | 1e-66 | PREDICTED: growth-regulating factor 1 isoform X2 | ||||
Swissprot | Q8L8A6 | 7e-54 | GRF5_ARATH; Growth-regulating factor 5 | ||||
TrEMBL | S8CBJ0 | 1e-113 | S8CBJ0_9LAMI; Uncharacterized protein (Fragment) | ||||
STRING | XP_010047491.1 | 4e-66 | (Eucalyptus grandis) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Asterids | OGEA743 | 23 | 84 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT3G13960.1 | 7e-56 | growth-regulating factor 5 |
Publications ? help Back to Top | |||
---|---|---|---|
|