PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

EPS64133.1

Organism

Genlisea aurea

Taxonomic ID

192259

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lentibulariaceae; Genlisea

Family

SBP

Protein Properties

Length: 112aa MW: 12396.5 Da PI: 8.6315

Description

SBP family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
EPS64133.1	genome	LSMU	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	SBP	128.5	2.6e-40	33	109	2	78
-SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S--- CS SBP 2 CqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkqa 78 Cq+++C+ad++ k yhrrh+vCe+h+ka vl++g qrfCqqCsrfh lsefD+ krsCrrrLa+hnerrrk+++ EPS64133.1 33 CQADNCTADMAAEKPYHRRHRVCEFHAKAVGVLLDGSWQRFCQQCSRFHGLSEFDDVKRSCRRRLAGHNERRRKSTS 109 **************************************************************************975 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
Gene3D	G3DSA:4.10.1100.10	8.5E-32	25	94	IPR004333	Transcription factor, SBP-box
PROSITE profile	PS51141	30.385	30	107	IPR004333	Transcription factor, SBP-box
SuperFamily	SSF103612	1.01E-35	32	110	IPR004333	Transcription factor, SBP-box
Pfam	PF03110	4.8E-31	33	106	IPR004333	Transcription factor, SBP-box

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0009911	Biological Process	positive regulation of flower development
GO:0010228	Biological Process	vegetative to reproductive phase transition of meristem
GO:0010229	Biological Process	inflorescence development
GO:0010321	Biological Process	regulation of vegetative phase change
GO:0005634	Cellular Component	nucleus
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 112 aa Download sequence Send to blast
DEEEDEAKSW SSRRKGGGEA GGGGGGGGGS RSCQADNCTA DMAAEKPYHR RHRVCEFHAK 60 AVGVLLDGSW QRFCQQCSRF HGLSEFDDVK RSCRRRLAGH NERRRKSTSD SH

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
1ul4_A	1e-37	23	106	1	84	squamosa promoter binding protein-like 4
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Probable transcriptional factor. Binds to the promoter of the SQUAMOSA gene.

Binding Motif ? help Back to Top
Motif ID	Method	Source	Motif file
MP00290	DAP	Transfer from AT2G33810	Download

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_011096328.1	4e-43	squamosa promoter-binding protein 1
Swissprot	Q38741	1e-42	SBP1_ANTMA; Squamosa promoter-binding protein 1
TrEMBL	S8DMB2	2e-74	S8DMB2_9LAMI; Uncharacterized protein (Fragment)
STRING	Solyc02g077920.2.1	2e-40	(Solanum lycopersicum)
STRING	Migut.M01124.1.p	3e-40	(Erythranthe guttata)
STRING	XP_010108163.1	6e-40	(Morus notabilis)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Asterids	OGEA749	24	105

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT2G33810.1	1e-39	squamosa promoter binding protein-like 3

Publications ? help Back to Top
Leushkin EV, et al. The miniature genome of a carnivorous plant Genlisea aurea contains a low number of genes and short non-coding sequences. BMC Genomics, 2013. 14: p. 476 [PMID:23855885] Klein J,Saedler H,Huijser P A new family of DNA binding proteins includes putative transcriptional regulators of the Antirrhinum majus floral meristem identity gene SQUAMOSA. Mol. Gen. Genet., 1996. 250(1): p. 7-16 [PMID:8569690]