PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | EPS62922.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lentibulariaceae; Genlisea
|
||||||||
Family | TCP | ||||||||
Protein Properties | Length: 93aa MW: 10404.9 Da PI: 10.7282 | ||||||||
Description | TCP family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | TCP | 112.8 | 4.8e-35 | 25 | 88 | 2 | 65 |
TCP 2 agkkdrhskihTkvggRdRRvRlsaecaarfFdLqdeLGfdkdsktieWLlqqakpaikeltgt 65 +g+kdrhsk++T++g+RdRRvRl a++a++f+d+qd+LG+d++sk+++WL+++ak ai+el+++ EPS62922.1 25 TGRKDRHSKVCTAKGPRDRRVRLAAHTAIQFYDVQDRLGYDRPSKAVDWLIKKAKNAIDELAEL 88 79***********************************************************987 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Pfam | PF03634 | 5.6E-32 | 25 | 87 | IPR005333 | Transcription factor, TCP |
PROSITE profile | PS51369 | 32.979 | 27 | 85 | IPR017887 | Transcription factor TCP subgroup |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 93 aa Download sequence Send to blast |
PSRLGPRSGA GEIVEVQGGH IVRSTGRKDR HSKVCTAKGP RDRRVRLAAH TAIQFYDVQD 60 RLGYDRPSKA VDWLIKKAKN AIDELAELPP WHP |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
5zkt_A | 7e-22 | 32 | 85 | 1 | 54 | Putative transcription factor PCF6 |
5zkt_B | 7e-22 | 32 | 85 | 1 | 54 | Putative transcription factor PCF6 |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor playing a pivotal role in the control of morphogenesis of shoot organs by negatively regulating the expression of boundary-specific genes such as CUC genes, probably through the induction of miRNA (e.g. miR164) (PubMed:12931144, PubMed:17307931). Required during early steps of embryogenesis (PubMed:15634699). Participates in ovule develpment (PubMed:25378179). Activates LOX2 expression by binding to the 5'-GGACCA-3' motif found in its promoter (PubMed:18816164). {ECO:0000269|PubMed:12931144, ECO:0000269|PubMed:15634699, ECO:0000269|PubMed:17307931, ECO:0000269|PubMed:18816164, ECO:0000269|PubMed:25378179}. |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Repressed by the miRNA miR-JAW/miR319 (PubMed:12931144, PubMed:18816164). {ECO:0000269|PubMed:12931144, ECO:0000269|PubMed:18816164}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_010277724.1 | 1e-54 | PREDICTED: transcription factor TCP4 | ||||
Refseq | XP_021890224.1 | 1e-54 | transcription factor TCP4 | ||||
Swissprot | Q8LPR5 | 4e-52 | TCP4_ARATH; Transcription factor TCP4 | ||||
TrEMBL | S8DSZ8 | 2e-61 | S8DSZ8_9LAMI; Uncharacterized protein (Fragment) | ||||
STRING | XP_010277724.1 | 5e-54 | (Nelumbo nucifera) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Asterids | OGEA6607 | 22 | 34 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT3G15030.3 | 2e-54 | TCP family protein |