PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | EPS62440.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lentibulariaceae; Genlisea
|
||||||||
Family | MYB | ||||||||
Protein Properties | Length: 117aa MW: 13448.5 Da PI: 10.8589 | ||||||||
Description | MYB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 58.9 | 1.1e-18 | 14 | 61 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 +g+WT+eEd llv +v+q+G g+W ++++ g+ R+ k+c++rw +yl EPS62440.1 14 KGPWTPEEDILLVSYVQQHGAGNWIAVPSNAGLLRCSKSCRLRWTNYL 61 79******************************99************97 PP | |||||||
2 | Myb_DNA-binding | 52.5 | 1.1e-16 | 67 | 110 | 1 | 46 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 rg++T++Ed+ +v++ ++lG++ W++Ia++++ Rt++++k++w++ EPS62440.1 67 RGNFTEQEDKTIVHLQALLGNR-WAAIASYLP-QRTDNDIKNYWNT 110 89********************.*********.***********97 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS51294 | 16.218 | 9 | 61 | IPR017930 | Myb domain |
SuperFamily | SSF46689 | 1.08E-31 | 11 | 108 | IPR009057 | Homeodomain-like |
SMART | SM00717 | 3.1E-13 | 13 | 63 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 4.3E-17 | 14 | 61 | IPR001005 | SANT/Myb domain |
Gene3D | G3DSA:1.10.10.60 | 4.2E-25 | 15 | 68 | IPR009057 | Homeodomain-like |
CDD | cd00167 | 1.33E-10 | 16 | 61 | No hit | No description |
PROSITE profile | PS51294 | 24.242 | 62 | 116 | IPR017930 | Myb domain |
SMART | SM00717 | 7.4E-15 | 66 | 114 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 1.5E-15 | 67 | 110 | IPR001005 | SANT/Myb domain |
Gene3D | G3DSA:1.10.10.60 | 8.1E-25 | 69 | 115 | IPR009057 | Homeodomain-like |
CDD | cd00167 | 2.34E-10 | 69 | 112 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 117 aa Download sequence Send to blast |
MGRPPFSNKI GVKKGPWTPE EDILLVSYVQ QHGAGNWIAV PSNAGLLRCS KSCRLRWTNY 60 LRPGIKRGNF TEQEDKTIVH LQALLGNRWA AIASYLPQRT DNDIKNYWNT RLKKKKK |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1a5j_A | 9e-28 | 14 | 115 | 7 | 107 | B-MYB |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor. {ECO:0000305}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_012438755.1 | 2e-72 | PREDICTED: myb-related protein 306 | ||||
Refseq | XP_021285931.1 | 2e-72 | myb-related protein 306-like | ||||
Swissprot | P81392 | 9e-72 | MYB06_ANTMA; Myb-related protein 306 | ||||
TrEMBL | S8C6N1 | 7e-82 | S8C6N1_9LAMI; Uncharacterized protein (Fragment) | ||||
STRING | Gorai.008G192900.1 | 7e-72 | (Gossypium raimondii) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Asterids | OGEA12 | 24 | 2154 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G62470.2 | 3e-73 | myb domain protein 96 |
Publications ? help Back to Top | |||
---|---|---|---|
|