PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | EPS61539.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lentibulariaceae; Genlisea
|
||||||||
Family | MYB | ||||||||
Protein Properties | Length: 165aa MW: 18829.4 Da PI: 9.9895 | ||||||||
Description | MYB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 58.3 | 1.7e-18 | 14 | 61 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 +g+WT+eEd++l+++vk +G g+W++ ++ g+ R++k+c++rw +yl EPS61539.1 14 KGAWTKEEDQRLINYVKAHGEGCWRSLPKAAGLLRCGKSCRLRWINYL 61 79******************************99************97 PP | |||||||
2 | Myb_DNA-binding | 57.2 | 3.9e-18 | 67 | 112 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 rg+++++Ede++++++ +lG++ W+ Ia +++ gRt++++k++w+++l EPS61539.1 67 RGNFSEDEDEIIIKLHSLLGNK-WSMIAGRLP-GRTDNEIKNYWNTHL 112 89********************.*********.************996 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:1.10.10.60 | 4.3E-25 | 5 | 64 | IPR009057 | Homeodomain-like |
PROSITE profile | PS51294 | 17.471 | 9 | 61 | IPR017930 | Myb domain |
SMART | SM00717 | 3.9E-14 | 13 | 63 | IPR001005 | SANT/Myb domain |
SuperFamily | SSF46689 | 3.07E-30 | 13 | 108 | IPR009057 | Homeodomain-like |
Pfam | PF00249 | 1.2E-16 | 14 | 61 | IPR001005 | SANT/Myb domain |
CDD | cd00167 | 4.32E-11 | 16 | 61 | No hit | No description |
PROSITE profile | PS51294 | 28.5 | 62 | 116 | IPR017930 | Myb domain |
Gene3D | G3DSA:1.10.10.60 | 2.7E-28 | 65 | 117 | IPR009057 | Homeodomain-like |
SMART | SM00717 | 7.8E-17 | 66 | 114 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 8.5E-16 | 67 | 112 | IPR001005 | SANT/Myb domain |
CDD | cd00167 | 5.53E-12 | 69 | 112 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0009739 | Biological Process | response to gibberellin | ||||
GO:0009751 | Biological Process | response to salicylic acid | ||||
GO:0009753 | Biological Process | response to jasmonic acid | ||||
GO:0010224 | Biological Process | response to UV-B | ||||
GO:0045892 | Biological Process | negative regulation of transcription, DNA-templated | ||||
GO:1903086 | Biological Process | negative regulation of sinapate ester biosynthetic process | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 165 aa Download sequence Send to blast |
MGRSPCCEKA HTNKGAWTKE EDQRLINYVK AHGEGCWRSL PKAAGLLRCG KSCRLRWINY 60 LRPDLKRGNF SEDEDEIIIK LHSLLGNKWS MIAGRLPGRT DNEIKNYWNT HLKRKLISRG 120 IDPQTHRPLI SAKIQPSKSE QQTVSIRTPT TENSDNNICT SSTTD |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1h8a_C | 8e-31 | 13 | 116 | 26 | 128 | MYB TRANSFORMING PROTEIN |
Search in ModeBase |
Binding Motif ? help Back to Top | |||
---|---|---|---|
Motif ID | Method | Source | Motif file |
MP00479 | DAP | Transfer from AT4G38620 | Download |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: By ethylene, asbscisic acid (ABA), auxin (IAA), and Pseudomonas syringae pv. phaseolica. {ECO:0000269|PubMed:9839469}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | Retrieve |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_012075785.1 | 1e-91 | transcription factor MYB6 | ||||
Swissprot | Q38851 | 3e-89 | MYB6_ARATH; Transcription repressor MYB6 | ||||
TrEMBL | S8C4F1 | 1e-119 | S8C4F1_9LAMI; Uncharacterized protein (Fragment) | ||||
STRING | A0A087GQC3 | 2e-91 | (Arabis alpina) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Asterids | OGEA12 | 24 | 2154 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT4G09460.1 | 1e-91 | myb domain protein 6 |
Publications ? help Back to Top | |||
---|---|---|---|
|