PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID EPS61323.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lentibulariaceae; Genlisea
Family GRAS
Protein Properties Length: 549aa    MW: 59876.3 Da    PI: 4.8632
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
EPS61323.1genomeLSMUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS4441e-1351875481374
        GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfshltaN 99 
                 lv++L++cAeav++++++la+a+++++  la +++ +m+++a+yf+eALa+r++r        l ps+++++  +++l  +  f+e++P+lkf+h+taN
  EPS61323.1 187 LVHTLMACAEAVQQENFKLAEAFVKNIGFLAVSQAGAMRKVATYFAEALARRIYR--------LYPSNSQDSAFADTL--QMHFYEACPYLKFAHFTAN 275
                 689****************************************************........555655544444444..345**************** PP

        GRAS 100 qaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesgskeeleetgerLakfAeelgvpfefnvlvakrledleleeLrvkp 198
                 qaIlea++g+ervH+iDf+++qG+QWpaLl+aLa Rp+gpp++R+Tg+g+   ++    +e+g+rLa++A++++v+fe+n +va +l+dl+ ++L++++
  EPS61323.1 276 QAILEAFAGKERVHVIDFSMKQGMQWPALLHALAFRPGGPPTFRLTGIGH---DDGSHSQEVGWRLADLAKTVNVEFEYNNVVAASLSDLDASALDIRE 371
                 **************************************************...68999***************************************** PP

        GRAS 199 gEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpres....eerikvErellgre 293
                 gE++aVn+v++lh+ll++++++e     v++lv++l+P++++vveqea+hn++ Fl+rf+eal+yys+lfdsle+  +  +     e++ +++++lgr+
  EPS61323.1 372 GETVAVNSVFELHQLLARPGAVER----VMDLVRGLKPEILTVVEQEANHNGSFFLDRFTEALHYYSTLFDSLESCCGGSDgavsGEDKLMSEVYLGRQ 466
                 *******************99999....**********************************************998776666779************* PP

        GRAS 294 ivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvk.sdgyrveeesgslvlgWkdrpLvsvSaWr 374
                 i+nvvacega+r+erhetl++Wr+r++++GFkpv+l+++++kqa lll+ ++ +dgyrvee++g+l+lgW++rpL+++SaW+
  EPS61323.1 467 ICNVVACEGADRVERHETLAQWRSRFSSSGFKPVHLGSNVYKQAILLLAVFAgGDGYRVEENKGCLTLGWHTRPLIATSAWK 548
                 *********************************************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF120411.1E-32875IPR021914Transcriptional factor DELLA, N-terminal
SMARTSM011292.6E-33881No hitNo description
SuperFamilySSF1014476.8E-6131141No hitNo description
PROSITE profilePS5098566.079161527IPR005202Transcription factor GRAS
PfamPF035143.5E-133187548IPR005202Transcription factor GRAS
SuperFamilySSF1014476.8E-6246296No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009723Biological Processresponse to ethylene
GO:0009737Biological Processresponse to abscisic acid
GO:0009867Biological Processjasmonic acid mediated signaling pathway
GO:0009938Biological Processnegative regulation of gibberellic acid mediated signaling pathway
GO:0010187Biological Processnegative regulation of seed germination
GO:0010218Biological Processresponse to far red light
GO:0042176Biological Processregulation of protein catabolic process
GO:0042538Biological Processhyperosmotic salinity response
GO:2000033Biological Processregulation of seed dormancy process
GO:2000377Biological Processregulation of reactive oxygen species metabolic process
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 549 aa     Download sequence    Send to blast
EADDSGVDEL FAVLGYNVRS SDMAEVAQKI QQLEEAMGNV QRDGLSQLAS DTIHYNPSDL  60
SSWLESMISG LNPLPDFDSS ADPFLDSSTV TSVDNSGGGG SVNSCSTRMA VDLDFGSDLI  120
AIPGKALYPR PPPPPPPPPP PQQQQQHQPQ AKKAKTSSYL GNSIPSGLEE PPTRSLLVDS  180
QENGIRLVHT LMACAEAVQQ ENFKLAEAFV KNIGFLAVSQ AGAMRKVATY FAEALARRIY  240
RLYPSNSQDS AFADTLQMHF YEACPYLKFA HFTANQAILE AFAGKERVHV IDFSMKQGMQ  300
WPALLHALAF RPGGPPTFRL TGIGHDDGSH SQEVGWRLAD LAKTVNVEFE YNNVVAASLS  360
DLDASALDIR EGETVAVNSV FELHQLLARP GAVERVMDLV RGLKPEILTV VEQEANHNGS  420
FFLDRFTEAL HYYSTLFDSL ESCCGGSDGA VSGEDKLMSE VYLGRQICNV VACEGADRVE  480
RHETLAQWRS RFSSSGFKPV HLGSNVYKQA ILLLAVFAGG DGYRVEENKG CLTLGWHTRP  540
LIATSAWKL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5b3g_A4e-6918254714378Protein SCARECROW
5b3h_A4e-6918254713377Protein SCARECROW
5b3h_D4e-6918254713377Protein SCARECROW
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtProbable transcriptional regulator that acts as a repressor of the gibberellin (GA) signaling pathway. Probably acts by participating in large multiprotein complexes that repress transcription of GA-inducible genes. Upon GA application, it is degraded by the proteasome, allowing the GA signaling pathway.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00611ChIP-seqTransfer from AT2G01570Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011070609.10.0DELLA protein GAI1
SwissprotQ8S4W70.0GAI1_VITVI; DELLA protein GAI1
TrEMBLS8DEW50.0S8DEW5_9LAMI; Uncharacterized protein (Fragment)
STRINGMigut.E00445.1.p0.0(Erythranthe guttata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA21262462
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G14920.10.0GRAS family protein
Publications ? help Back to Top
  1. Leushkin EV, et al.
    The miniature genome of a carnivorous plant Genlisea aurea contains a low number of genes and short non-coding sequences.
    BMC Genomics, 2013. 14: p. 476
    [PMID:23855885]