PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | EPS60753.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lentibulariaceae; Genlisea
|
||||||||
Family | MYB_related | ||||||||
Protein Properties | Length: 82aa MW: 9396.44 Da PI: 11.7642 | ||||||||
Description | MYB_related family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 45.5 | 1.7e-14 | 12 | 56 | 3 | 47 |
SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS Myb_DNA-binding 3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 +WT++E++l++ + +++G g+W++I+r + k+R++ q+ s+ qky EPS60753.1 12 PWTQDEHKLFLIGLERFGRGDWRSISRNVVKTRSPTQVASHAQKY 56 7*******************************************9 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:1.10.10.60 | 2.0E-10 | 5 | 60 | IPR009057 | Homeodomain-like |
PROSITE profile | PS51294 | 16.778 | 5 | 61 | IPR017930 | Myb domain |
SuperFamily | SSF46689 | 5.91E-17 | 7 | 61 | IPR009057 | Homeodomain-like |
TIGRFAMs | TIGR01557 | 4.7E-16 | 8 | 59 | IPR006447 | Myb domain, plants |
SMART | SM00717 | 1.8E-8 | 9 | 59 | IPR001005 | SANT/Myb domain |
CDD | cd00167 | 1.14E-8 | 12 | 57 | No hit | No description |
Pfam | PF00249 | 9.8E-12 | 12 | 56 | IPR001005 | SANT/Myb domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 82 aa Download sequence Send to blast |
SRAGDERKKG IPWTQDEHKL FLIGLERFGR GDWRSISRNV VKTRSPTQVA SHAQKYFQRN 60 RSGGDSSSNG KQRKRSSIHD IT |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Involved in the dorsovental asymmetry of flowers. Promotes ventral identity. {ECO:0000269|PubMed:11937495, ECO:0000269|PubMed:9118809}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_011084236.1 | 2e-33 | transcription factor SRM1-like | ||||
Swissprot | Q8S9H7 | 5e-31 | DIV_ANTMA; Transcription factor DIVARICATA | ||||
TrEMBL | S8DD69 | 1e-52 | S8DD69_9LAMI; Uncharacterized protein (Fragment) | ||||
STRING | MLOC_20277.1 | 1e-33 | (Hordeum vulgare) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Asterids | OGEA5234 | 20 | 32 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G04760.1 | 3e-33 | MYB family protein |
Publications ? help Back to Top | |||
---|---|---|---|
|