PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | EPS60112.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lentibulariaceae; Genlisea
|
||||||||
Family | SBP | ||||||||
Protein Properties | Length: 137aa MW: 15126.2 Da PI: 10.4774 | ||||||||
Description | SBP family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | SBP | 130.3 | 6.8e-41 | 52 | 129 | 1 | 78 |
--SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S--- CS SBP 1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkqa 78 +C vegC+ dl++akeyhr+hkvCe+hsk+++v++ gle+rfCqqCsrfh+lsefD+ krsCrrrL +hn+rrrk+q+ EPS60112.1 52 RCVVEGCSLDLTTAKEYHRKHKVCEAHSKCSKVILGGLERRFCQQCSRFHSLSEFDDMKRSCRRRLMDHNARRRKPQP 129 6**************************************************************************997 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:4.10.1100.10 | 1.7E-31 | 50 | 114 | IPR004333 | Transcription factor, SBP-box |
PROSITE profile | PS51141 | 31.445 | 50 | 127 | IPR004333 | Transcription factor, SBP-box |
SuperFamily | SSF103612 | 2.22E-38 | 51 | 132 | IPR004333 | Transcription factor, SBP-box |
Pfam | PF03110 | 3.2E-30 | 53 | 126 | IPR004333 | Transcription factor, SBP-box |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0010358 | Biological Process | leaf shaping | ||||
GO:0045893 | Biological Process | positive regulation of transcription, DNA-templated | ||||
GO:0048510 | Biological Process | regulation of timing of transition from vegetative to reproductive phase | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 137 aa Download sequence Send to blast |
SAEQLIGLKL GKRTYFENTG GGGSSSSAAA KPGGPSSSSH RPSKATCRLV PRCVVEGCSL 60 DLTTAKEYHR KHKVCEAHSK CSKVILGGLE RRFCQQCSRF HSLSEFDDMK RSCRRRLMDH 120 NARRRKPQPE TAFSSSP |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1ul4_A | 1e-29 | 53 | 126 | 11 | 84 | squamosa promoter binding protein-like 4 |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Trans-acting factor that binds specifically to the consensus nucleotide sequence 5'-TNCGTACAA-3' (By similarity). May be involved in panicle development. {ECO:0000250}. | |||||
UniProt | Trans-acting factor that binds specifically to the consensus nucleotide sequence 5'-TNCGTACAA-3' (By similarity). May be involved in panicle development. {ECO:0000250}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_011086806.1 | 7e-57 | squamosa promoter-binding-like protein 12 | ||||
Refseq | XP_011086808.1 | 7e-57 | squamosa promoter-binding-like protein 12 | ||||
Refseq | XP_020551644.1 | 7e-57 | squamosa promoter-binding-like protein 12 | ||||
Swissprot | A2X0Q6 | 6e-49 | SPL3_ORYSI; Squamosa promoter-binding-like protein 3 | ||||
Swissprot | A3A2Z8 | 6e-49 | SPL3_ORYSJ; Squamosa promoter-binding-like protein 3 | ||||
TrEMBL | S8DKR8 | 6e-95 | S8DKR8_9LAMI; Uncharacterized protein (Fragment) | ||||
STRING | VIT_01s0010g03710.t01 | 3e-52 | (Vitis vinifera) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Asterids | OGEA4129 | 24 | 44 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G43270.3 | 5e-44 | squamosa promoter binding protein-like 2 |
Publications ? help Back to Top | |||
---|---|---|---|
|