PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | EPS59677.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lentibulariaceae; Genlisea
|
||||||||
Family | SBP | ||||||||
Protein Properties | Length: 76aa MW: 8949.08 Da PI: 9.1974 | ||||||||
Description | SBP family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | SBP | 129.8 | 9.8e-41 | 1 | 75 | 2 | 76 |
-SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S- CS SBP 2 CqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkk 76 Cqve+C+ad++ k+yhrrh+vCe h+ka +vl++g qrfCqqCsrfhelsefD+ krsCrrrLa+hnerrrk+ EPS59677.1 1 CQVESCSADMAAEKQYHRRHRVCESHAKAVAVLLDGAWQRFCQQCSRFHELSEFDDVKRSCRRRLAGHNERRRKS 75 *************************************************************************97 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:4.10.1100.10 | 2.5E-30 | 1 | 62 | IPR004333 | Transcription factor, SBP-box |
PROSITE profile | PS51141 | 31.248 | 1 | 75 | IPR004333 | Transcription factor, SBP-box |
SuperFamily | SSF103612 | 9.42E-36 | 1 | 75 | IPR004333 | Transcription factor, SBP-box |
Pfam | PF03110 | 6.0E-33 | 1 | 74 | IPR004333 | Transcription factor, SBP-box |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 76 aa Download sequence Send to blast |
CQVESCSADM AAEKQYHRRH RVCESHAKAV AVLLDGAWQR FCQQCSRFHE LSEFDDVKRS 60 CRRRLAGHNE RRRKSS |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1ul4_A | 2e-34 | 1 | 74 | 11 | 84 | squamosa promoter binding protein-like 4 |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Probable transcriptional factor. Binds to the promoter of the SQUAMOSA gene. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_015056436.1 | 3e-37 | squamosa promoter-binding protein 1-like | ||||
Swissprot | Q38741 | 5e-37 | SBP1_ANTMA; Squamosa promoter-binding protein 1 | ||||
TrEMBL | S8DJK7 | 4e-47 | S8DJK7_9LAMI; Uncharacterized protein (Fragment) | ||||
STRING | VIT_10s0003g00050.t01 | 2e-36 | (Vitis vinifera) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Asterids | OGEA749 | 24 | 105 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT2G33810.1 | 1e-38 | squamosa promoter binding protein-like 3 |
Publications ? help Back to Top | |||
---|---|---|---|
|