PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | EPS59618.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lentibulariaceae; Genlisea
|
||||||||
Family | Whirly | ||||||||
Protein Properties | Length: 161aa MW: 17922.6 Da PI: 10.1075 | ||||||||
Description | Whirly family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Whirly | 179 | 9.7e-56 | 8 | 145 | 2 | 138 |
Whirly 2 vyktkaalkvkavrptfealdsgnlklkraGglllelanataerkydWekkqsfalsatevaelvdlaskesceffhdpaakgsneGkvrkalkvePlp 100 ++k+kaal+ + p +++l+ g ++kr+G ++l+l +a++erkydWek+q+fals+ ev+++++l+sk+sceffhdp++k+sneGkvrk+l+++ + EPS59618.1 8 IFKGKAALSAQMLSPRLSKLENGDYRVKRPGVIMLTLWPAIGERKYDWEKRQQFALSVNEVGSVISLGSKQSCEFFHDPSMKSSNEGKVRKSLSIKLHD 106 9************************************************************************************************** PP Whirly 101 dGs.GlfvnlsvtnslvkgnesfsvPvskaefavlrsll 138 dGs +f++lsv ns++k+ +++svPv+ +efavlr ++ EPS59618.1 107 DGSgCYFISLSVANSVLKTSDRLSVPVAASEFAVLRAAF 145 ***669******************************998 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:2.30.31.10 | 1.3E-65 | 1 | 160 | IPR009044 | ssDNA-binding transcriptional regulator |
SuperFamily | SSF54447 | 2.51E-57 | 1 | 159 | IPR009044 | ssDNA-binding transcriptional regulator |
Pfam | PF08536 | 1.3E-53 | 8 | 143 | IPR013742 | Plant transcription factor |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006281 | Biological Process | DNA repair | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005739 | Cellular Component | mitochondrion | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 161 aa Download sequence Send to blast |
RVFAPYTIFK GKAALSAQML SPRLSKLENG DYRVKRPGVI MLTLWPAIGE RKYDWEKRQQ 60 FALSVNEVGS VISLGSKQSC EFFHDPSMKS SNEGKVRKSL SIKLHDDGSG CYFISLSVAN 120 SVLKTSDRLS VPVAASEFAV LRAAFTFALP QLLGWDQFNN Q |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
3n1h_A | 4e-76 | 1 | 161 | 10 | 169 | StWhy2 |
3n1i_A | 4e-76 | 1 | 161 | 10 | 169 | protein StWhy2 |
3n1j_A | 4e-76 | 1 | 161 | 10 | 169 | Protein StWhy2 |
3n1k_A | 4e-76 | 1 | 161 | 10 | 169 | protein StWhy2 |
3n1l_A | 4e-76 | 1 | 161 | 10 | 169 | protein StWhy2 |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Single-stranded DNA-binding protein that may be involved in the maintenance of mitochondrial genome stability by preventing break-induced DNA rearrangements. {ECO:0000269|PubMed:21911368}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_011095185.1 | 8e-83 | single-stranded DNA-bindig protein WHY2, mitochondrial isoform X2 | ||||
Swissprot | D9J034 | 1e-74 | WHY2_SOLTU; Single-stranded DNA-binding protein WHY2, mitochondrial | ||||
TrEMBL | S8DAA3 | 1e-115 | S8DAA3_9LAMI; Uncharacterized protein (Fragment) | ||||
STRING | Migut.C01402.1.p | 1e-81 | (Erythranthe guttata) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Asterids | OGEA9782 | 22 | 28 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G71260.1 | 1e-73 | WHIRLY 2 |
Publications ? help Back to Top | |||
---|---|---|---|
|