PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | EPS59067.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lentibulariaceae; Genlisea
|
||||||||
Family | MYB | ||||||||
Protein Properties | Length: 122aa MW: 14321.4 Da PI: 10.3246 | ||||||||
Description | MYB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 57.5 | 3.2e-18 | 14 | 61 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 rg W++eEde+l+++++ +G g+W+ ++++ g+ R++k+c++rw +yl EPS59067.1 14 RGLWSPEEDEKLIRYITTHGYGCWSEVPQKAGLQRCGKSCRLRWINYL 61 789*******************************************97 PP | |||||||
2 | Myb_DNA-binding | 53.4 | 6.1e-17 | 67 | 111 | 1 | 47 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 rgr+T++E++l++ ++ G++ W+ Ia++++ gRt++++k++w+++ EPS59067.1 67 RGRFTPDEEKLIITLHGAVGNR-WAHIASHLP-GRTDNEIKNYWNSW 111 89********************.*********.************98 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:1.10.10.60 | 3.3E-26 | 6 | 64 | IPR009057 | Homeodomain-like |
PROSITE profile | PS51294 | 17.18 | 9 | 61 | IPR017930 | Myb domain |
SuperFamily | SSF46689 | 6.11E-31 | 11 | 108 | IPR009057 | Homeodomain-like |
SMART | SM00717 | 2.8E-12 | 13 | 63 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 3.8E-16 | 14 | 61 | IPR001005 | SANT/Myb domain |
CDD | cd00167 | 1.17E-10 | 17 | 61 | No hit | No description |
PROSITE profile | PS51294 | 24.8 | 62 | 116 | IPR017930 | Myb domain |
Gene3D | G3DSA:1.10.10.60 | 1.9E-25 | 65 | 116 | IPR009057 | Homeodomain-like |
SMART | SM00717 | 4.0E-16 | 66 | 114 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 1.2E-15 | 67 | 111 | IPR001005 | SANT/Myb domain |
CDD | cd00167 | 1.16E-10 | 69 | 112 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0045893 | Biological Process | positive regulation of transcription, DNA-templated | ||||
GO:1901430 | Biological Process | positive regulation of syringal lignin biosynthetic process | ||||
GO:2000652 | Biological Process | regulation of secondary cell wall biogenesis | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 122 aa Download sequence Send to blast |
MGHHSCCNQQ KVKRGLWSPE EDEKLIRYIT THGYGCWSEV PQKAGLQRCG KSCRLRWINY 60 LRPDIRRGRF TPDEEKLIIT LHGAVGNRWA HIASHLPGRT DNEIKNYWNS WIKKKIRNPT 120 SP |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1a5j_A | 5e-27 | 14 | 116 | 7 | 108 | B-MYB |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Probable transcription factor. {ECO:0000250}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_011074190.1 | 7e-85 | transcription repressor MYB6 | ||||
Swissprot | Q8LPH6 | 3e-63 | MYB86_ARATH; Transcription factor MYB86 | ||||
TrEMBL | S8DI26 | 5e-86 | S8DI26_9LAMI; Uncharacterized protein (Fragment) | ||||
STRING | XP_009363397.1 | 2e-83 | (Pyrus x bretschneideri) | ||||
STRING | POPTR_0003s13190.1 | 7e-84 | (Populus trichocarpa) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Asterids | OGEA12 | 24 | 2154 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G63910.1 | 6e-85 | myb domain protein 103 |
Publications ? help Back to Top | |||
---|---|---|---|
|