PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | EPS59038.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lentibulariaceae; Genlisea
|
||||||||
Family | MYB | ||||||||
Protein Properties | Length: 160aa MW: 18176.4 Da PI: 10.3009 | ||||||||
Description | MYB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 57.5 | 3.1e-18 | 37 | 84 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 +g+WT Ed +l+d+v+++G g+W+++ ++ g+ R++k+c++rw ++l EPS59038.1 37 KGPWTSGEDAILIDYVNKHGEGNWNAVQKHSGLSRCGKSCRLRWANHL 84 79******************************************9996 PP | |||||||
2 | Myb_DNA-binding | 52.3 | 1.3e-16 | 90 | 133 | 1 | 46 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 +g++T+eE+ +++++++++G++ W++ a +++ gRt++++k++w++ EPS59038.1 90 KGAFTAEEERRIIELHAKMGNK-WARMATELP-GRTDNEIKNFWNT 133 799*******************.*********.***********97 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS51294 | 16.133 | 32 | 84 | IPR017930 | Myb domain |
SuperFamily | SSF46689 | 7.55E-31 | 35 | 131 | IPR009057 | Homeodomain-like |
SMART | SM00717 | 7.5E-15 | 36 | 86 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 3.1E-16 | 37 | 84 | IPR001005 | SANT/Myb domain |
Gene3D | G3DSA:1.10.10.60 | 3.1E-25 | 38 | 91 | IPR009057 | Homeodomain-like |
CDD | cd00167 | 6.03E-11 | 39 | 84 | No hit | No description |
PROSITE profile | PS51294 | 25.577 | 85 | 139 | IPR017930 | Myb domain |
SMART | SM00717 | 1.1E-15 | 89 | 137 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 2.2E-15 | 90 | 133 | IPR001005 | SANT/Myb domain |
Gene3D | G3DSA:1.10.10.60 | 1.0E-25 | 92 | 138 | IPR009057 | Homeodomain-like |
CDD | cd00167 | 2.59E-11 | 92 | 133 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0009723 | Biological Process | response to ethylene | ||||
GO:0009751 | Biological Process | response to salicylic acid | ||||
GO:0043068 | Biological Process | positive regulation of programmed cell death | ||||
GO:0045893 | Biological Process | positive regulation of transcription, DNA-templated | ||||
GO:0045926 | Biological Process | negative regulation of growth | ||||
GO:0048235 | Biological Process | pollen sperm cell differentiation | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 160 aa Download sequence Send to blast |
LKMSMTSDSD ERMVPQNSID SPSNNGENVG SNGPLKKGPW TSGEDAILID YVNKHGEGNW 60 NAVQKHSGLS RCGKSCRLRW ANHLRPDLKK GAFTAEEERR IIELHAKMGN KWARMATELP 120 GRTDNEIKNF WNTRIKRRQR AGLPIYPNYI SSQVKNESQQ |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1a5j_A | 5e-32 | 35 | 138 | 5 | 107 | B-MYB |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcriptional activator of gibberellin-dependent alpha-amylase expression in aleurone cells. Involved in pollen and floral organs development. May bind to the 5'-TAACAAA-3' box of alpha-amylase promoter. {ECO:0000269|PubMed:9150608}. |
Binding Motif ? help Back to Top | |||
---|---|---|---|
Motif ID | Method | Source | Motif file |
MP00348 | DAP | Transfer from AT3G11440 | Download |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: By gibberellin in aleurone cells. {ECO:0000269|PubMed:9150608}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | - | Retrieve |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_012838469.1 | 2e-89 | PREDICTED: transcription factor GAMYB-like | ||||
Refseq | XP_012838470.1 | 2e-89 | PREDICTED: transcription factor GAMYB-like | ||||
Refseq | XP_012838471.1 | 2e-89 | PREDICTED: transcription factor GAMYB-like | ||||
Refseq | XP_012838472.1 | 2e-89 | PREDICTED: transcription factor GAMYB-like | ||||
Refseq | XP_027081255.1 | 3e-89 | transcription factor GAMYB-like | ||||
Refseq | XP_027179014.1 | 2e-89 | transcription factor GAMYB-like | ||||
Swissprot | A2WW87 | 2e-77 | GAM1_ORYSI; Transcription factor GAMYB | ||||
TrEMBL | S8D8L6 | 1e-116 | S8D8L6_9LAMI; Uncharacterized protein (Fragment) | ||||
STRING | Migut.N02411.1.p | 6e-89 | (Erythranthe guttata) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Asterids | OGEA2021 | 23 | 58 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT3G11440.1 | 5e-72 | myb domain protein 65 |
Publications ? help Back to Top | |||
---|---|---|---|
|