PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | EPS57494.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lentibulariaceae; Genlisea
|
||||||||
Family | CPP | ||||||||
Protein Properties | Length: 163aa MW: 18204.8 Da PI: 8.1355 | ||||||||
Description | CPP family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | TCR | 53.6 | 4.5e-17 | 15 | 52 | 3 | 40 |
TCR 3 kkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNke 40 +k+CnCkkskClk+YC+Cfaag++C + C C dC+Nk EPS57494.1 15 CKRCNCKKSKCLKLYCDCFAAGVYCMDLCACVDCFNKP 52 89**********************************96 PP | |||||||
2 | TCR | 54 | 3.3e-17 | 100 | 138 | 1 | 39 |
TCR 1 kekkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNk 39 ++k+gCnCkks ClkkYCeC++ g+ Cs +C+Ce+CkN EPS57494.1 100 RHKRGCNCKKSGCLKKYCECYQVGVGCSLNCRCEGCKNA 138 589***********************************7 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SMART | SM01114 | 8.3E-17 | 13 | 54 | IPR033467 | Tesmin/TSO1-like CXC domain |
PROSITE profile | PS51634 | 35.902 | 14 | 140 | IPR005172 | CRC domain |
Pfam | PF03638 | 9.5E-13 | 16 | 51 | IPR005172 | CRC domain |
SMART | SM01114 | 1.1E-17 | 100 | 141 | IPR033467 | Tesmin/TSO1-like CXC domain |
Pfam | PF03638 | 8.7E-13 | 102 | 138 | IPR005172 | CRC domain |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 163 aa Download sequence Send to blast |
RRRRGEQMTG DGEGCKRCNC KKSKCLKLYC DCFAAGVYCM DLCACVDCFN KPVHEDTVLA 60 TRKQIESRNP LAFAPKVIRG SDHRQLEIGV DFTKTPASAR HKRGCNCKKS GCLKKYCECY 120 QVGVGCSLNC RCEGCKNAFG RKDGPNPKAD LEDDDEAEEE EKN |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
5fd3_A | 3e-21 | 16 | 137 | 12 | 120 | Protein lin-54 homolog |
5fd3_B | 3e-21 | 16 | 137 | 12 | 120 | Protein lin-54 homolog |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Plays a role in development of both male and female reproductive tissues. {ECO:0000250}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_011073448.1 | 7e-81 | protein tesmin/TSO1-like CXC 2 isoform X1 | ||||
Refseq | XP_011073452.1 | 4e-81 | protein tesmin/TSO1-like CXC 2 isoform X4 | ||||
Refseq | XP_020547912.1 | 2e-81 | protein tesmin/TSO1-like CXC 2 isoform X5 | ||||
Swissprot | F4JIF5 | 8e-78 | TCX2_ARATH; Protein tesmin/TSO1-like CXC 2 | ||||
TrEMBL | S8BSX3 | 1e-114 | S8BSX3_9LAMI; Uncharacterized protein (Fragment) | ||||
STRING | XP_006406130.1 | 5e-81 | (Eutrema salsugineum) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Asterids | OGEA6980 | 21 | 28 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT4G14770.1 | 1e-79 | TESMIN/TSO1-like CXC 2 |
Publications ? help Back to Top | |||
---|---|---|---|
|