PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | EPS57454.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lentibulariaceae; Genlisea
|
||||||||
Family | HD-ZIP | ||||||||
Protein Properties | Length: 199aa MW: 22386.8 Da PI: 6.2555 | ||||||||
Description | HD-ZIP family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Homeobox | 58.8 | 8.7e-19 | 20 | 73 | 3 | 56 |
--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS Homeobox 3 kRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 k+++++ eq+++Le+ Fe +++ ae++ +LA+ lgL+ rqV +WFqNrRa++k EPS57454.1 20 KKRRLNMEQVRTLEKNFELGNKLEAERKMQLARDLGLQPRQVAIWFQNRRARWK 73 456899***********************************************9 PP | |||||||
2 | HD-ZIP_I/II | 125.1 | 3.2e-40 | 19 | 109 | 1 | 91 |
HD-ZIP_I/II 1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreel 91 ekkrrl+ eqv++LE++Fe +kLe erK++lar+Lglqprqva+WFqnrRAR+ktkqlEkdy+ Lkr++++ k+en++L +++++L++e+ EPS57454.1 19 EKKRRLNMEQVRTLEKNFELGNKLEAERKMQLARDLGLQPRQVAIWFQNRRARWKTKQLEKDYDLLKRQFEEAKAENDALLAQNQKLHAEI 109 69**************************************************************************************987 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:1.10.10.60 | 3.4E-19 | 5 | 76 | IPR009057 | Homeodomain-like |
SuperFamily | SSF46689 | 9.8E-20 | 13 | 77 | IPR009057 | Homeodomain-like |
PROSITE profile | PS50071 | 17.459 | 15 | 75 | IPR001356 | Homeobox domain |
SMART | SM00389 | 1.6E-17 | 18 | 79 | IPR001356 | Homeobox domain |
Pfam | PF00046 | 3.5E-16 | 20 | 73 | IPR001356 | Homeobox domain |
CDD | cd00086 | 4.98E-16 | 20 | 76 | No hit | No description |
PRINTS | PR00031 | 4.8E-6 | 46 | 55 | IPR000047 | Helix-turn-helix motif |
PROSITE pattern | PS00027 | 0 | 50 | 73 | IPR017970 | Homeobox, conserved site |
PRINTS | PR00031 | 4.8E-6 | 55 | 71 | IPR000047 | Helix-turn-helix motif |
Pfam | PF02183 | 6.3E-13 | 75 | 116 | IPR003106 | Leucine zipper, homeobox-associated |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0009744 | Biological Process | response to sucrose | ||||
GO:0048826 | Biological Process | cotyledon morphogenesis | ||||
GO:0080022 | Biological Process | primary root development | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 199 aa Download sequence Send to blast |
GGGHGGEDEL SDDGSQGGEK KRRLNMEQVR TLEKNFELGN KLEAERKMQL ARDLGLQPRQ 60 VAIWFQNRRA RWKTKQLEKD YDLLKRQFEE AKAENDALLA QNQKLHAEIL ALKNMESINL 120 NKGTNDGGSS SDNTPGEKIK LEIDSSSPSN SKHNAIAQHY SKTEISPVKE ESAFCNIFCG 180 VDDHATAPGG FWPWIEQQH |
Nucleic Localization Signal ? help Back to Top | |||
---|---|---|---|
No. | Start | End | Sequence |
1 | 67 | 75 | RRARWKTKQ |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Probable transcription factor that may act in the sucrose-signaling pathway. {ECO:0000269|PubMed:11292072}. |
Binding Motif ? help Back to Top | |||
---|---|---|---|
Motif ID | Method | Source | Motif file |
MP00225 | DAP | Transfer from AT1G69780 | Download |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | Retrieve |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_002276889.1 | 2e-82 | PREDICTED: homeobox-leucine zipper protein ATHB-13 | ||||
Swissprot | Q8LC03 | 1e-75 | ATB13_ARATH; Homeobox-leucine zipper protein ATHB-13 | ||||
TrEMBL | S8BSU1 | 1e-145 | S8BSU1_9LAMI; Uncharacterized protein (Fragment) | ||||
STRING | VIT_01s0026g01950.t01 | 7e-82 | (Vitis vinifera) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Asterids | OGEA848 | 24 | 98 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G69780.1 | 5e-78 | HD-ZIP family protein |
Publications ? help Back to Top | |||
---|---|---|---|
|