PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cotton_A_36154_BGI-A2_v1.0
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family ARF
Protein Properties Length: 734aa    MW: 82026.5 Da    PI: 6.7046
Description ARF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cotton_A_36154_BGI-A2_v1.0genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B376.72.6e-24189289198
                                 EEEE-..-HHHHTT-EE--HHH.HTT.....---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT- CS
                          B3   1 ffkvltpsdvlksgrlvlpkkfaeeh.....ggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegD 78 
                                 f+kvlt sd++++g +++ +k+a+e+     +++ + +++l+ +d++g +W++k+i+r++++r++lt+GW+ Fv +++L +gD
  Cotton_A_36154_BGI-A2_v1.0 189 FCKVLTASDTSTHGGFSVLRKHATEClppldMNQATPTQELVAKDLHGYEWRFKHIFRGQPRRHLLTTGWSTFVTSKRLVAGD 271
                                 99****************************9555556679******************************************* PP

                                 EEEEEE-SSSEE..EEEEE- CS
                          B3  79 fvvFkldgrsefelvvkvfr 98 
                                 ++vF   + +++el+v+v+r
  Cotton_A_36154_BGI-A2_v1.0 272 SFVFL--RGENGELRVGVRR 289
                                 *****..449999*****98 PP

2Auxin_resp1058.9e-35315394183
                  Auxin_resp   1 aahaastksvFevvYnPrastseFvvkvekvekalkvkvsvGmRfkmafetedsserrlsGtvvgvsdldpvrWpnSkWrsLk 83 
                                 a+ha+st++ F v+Y+Pr+  s+F++ ++k+++al++k++vGmRfkm+fe+eds+err+sGt+vgv+d++p  W++SkWrsLk
  Cotton_A_36154_BGI-A2_v1.0 315 ASHAVSTQTLFVVYYKPRT--SQFIIGLNKYLEALSNKFTVGMRFKMRFEGEDSPERRFSGTIVGVEDFSP-YWKDSKWRSLK 394
                                 789***************6..9*************************************************.9********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019365.1E-41177318IPR015300DNA-binding pseudobarrel domain
Gene3DG3DSA:2.40.330.103.7E-41182304IPR015300DNA-binding pseudobarrel domain
CDDcd100175.37E-21187289No hitNo description
PfamPF023622.3E-22189289IPR003340B3 DNA binding domain
SMARTSM010197.5E-24189291IPR003340B3 DNA binding domain
PROSITE profilePS5086312.351189291IPR003340B3 DNA binding domain
PfamPF065073.6E-32315394IPR010525Auxin response factor
PfamPF023092.3E-7588657IPR033389AUX/IAA domain
SuperFamilySSF542771.91E-15614697No hitNo description
PROSITE profilePS5174528.257621702IPR000270PB1 domain
Gene3DG3DSA:3.10.20.2408.6E-4644695No hitNo description
PfamPF023093.2E-7667706IPR033389AUX/IAA domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009734Biological Processauxin-activated signaling pathway
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 734 aa     Download sequence    Send to blast
MSLGFITRAN HPVACFEAAN ERDVKNNTVN PNHTHPNAPP SSVPKTPLRN GFPSVGESSI  60
MANRGGVFSQ TNNVSSEGNG GDDLYMELWK LCAGPLVEAP RARERVYYFP QGHMEQLEAS  120
TNQELNQRIP LFNLPSKILC SVVHIQFLAE QETDEVYAQI TLMPEPNQPE PTTPDACLPE  180
PPKPTVHSFC KVLTASDTST HGGFSVLRKH ATECLPPLDM NQATPTQELV AKDLHGYEWR  240
FKHIFRGQPR RHLLTTGWST FVTSKRLVAG DSFVFLRGEN GELRVGVRRV ARQQSSMPTS  300
VISSQSMHLG VLATASHAVS TQTLFVVYYK PRTSQFIIGL NKYLEALSNK FTVGMRFKMR  360
FEGEDSPERR FSGTIVGVED FSPYWKDSKW RSLKVQWDEP ASIPRPDRVS PWEIEPFAAP  420
IPPTLDLSST ASAPWNSGVM HTHDLMRRNI TAEANRNENH VIWHMQTEMS SSCTSVLKTQ  480
NEGSWLSSPC MSVSKHRFPD ARDDSKCASG WPVLSGLSNP QVNNDSTFDP KEKVKKSETA  540
SSCRLFGIEL INHSASSRRL ERTPTQLSTM TASTAEGHHT LSPNNSCQKS EISKDSNEKQ  600
EQLQLQAKEI QSRQSCPSST RSRTKVQMQG VAVGRAVDLA MLEGYDQLID ELEEMFDIKG  660
ELRPRNKWEI VYTDDEGDMM LVGDDPWQEF CSMVRRIFIC LSQDVKKLST GSKLPMACIE  720
GGEGTVISSE SIEN
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4ldv_A1e-178724174355Auxin response factor 1
4ldw_A1e-178724174355Auxin response factor 1
4ldw_B1e-178724174355Auxin response factor 1
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtAuxin response factors (ARFs) are transcriptional factors that bind specifically to the DNA sequence 5'-TGTCTC-3' found in the auxin-responsive promoter elements (AuxREs). Could act as transcriptional activator or repressor. Formation of heterodimers with Aux/IAA proteins may alter their ability to modulate early auxin response genes expression. {ECO:0000269|PubMed:12036261}.
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankJX5850158e-58JX585015.1 Gossypium hirsutum clone NBRI_GE18462 microsatellite sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_017641962.10.0PREDICTED: auxin response factor 9-like
SwissprotQ9XED80.0ARFI_ARATH; Auxin response factor 9
TrEMBLA0A0B0NAI60.0A0A0B0NAI6_GOSAR; Auxin response factor
STRINGGorai.003G078000.10.0(Gossypium raimondii)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM27642762
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G23980.10.0auxin response factor 9