PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Cotton_A_34222_BGI-A2_v1.0 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
|
||||||||
Family | NAC | ||||||||
Protein Properties | Length: 78aa MW: 9527.91 Da PI: 6.8046 | ||||||||
Description | NAC family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NAM | 62.2 | 1.6e-19 | 19 | 68 | 2 | 52 |
NAM 2 ppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvk 52 pGfrFhPtdeelv +yL++kve+k++++ e ik++diy+++PwdLp+ ++ Cotton_A_34222_BGI-A2_v1.0 19 LPGFRFHPTDEELVGFYLRRKVEKKPISI-ELIKQIDIYQYDPWDLPNWLY 68 59***************************.89**************96443 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS51005 | 19.11 | 18 | 78 | IPR003441 | NAC domain |
SuperFamily | SSF101941 | 1.18E-18 | 18 | 68 | IPR003441 | NAC domain |
Pfam | PF02365 | 4.9E-9 | 20 | 61 | IPR003441 | NAC domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 78 aa Download sequence Send to blast |
MEDSIDDNKK KRNGEEIKLP GFRFHPTDEE LVGFYLRRKV EKKPISIELI KQIDIYQYDP 60 WDLPNWLYDT RKLHHIIT |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
3ulx_A | 5e-13 | 9 | 64 | 4 | 61 | Stress-induced transcription factor NAC1 |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Promotes periclinal root capforming cell divisions. Activates expression of its negative regulator SMB in a feedback loop for controlled switches in cell division plane. {ECO:0000269|PubMed:19081078}. |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Repressed by SMB in oriented-divised root cap stem cells. {ECO:0000269|PubMed:19081078}. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_017610401.1 | 7e-39 | PREDICTED: protein FEZ-like isoform X3 | ||||
Refseq | XP_017629011.1 | 3e-39 | PREDICTED: transcription factor JUNGBRUNNEN 1-like | ||||
Swissprot | Q9ZVH0 | 2e-22 | FEZ_ARATH; Protein FEZ | ||||
TrEMBL | A0A1U8KNI3 | 2e-37 | A0A1U8KNI3_GOSHI; protein FEZ isoform X4 | ||||
TrEMBL | A0A1U8KTF0 | 2e-37 | A0A1U8KTF0_GOSHI; transcription factor JUNGBRUNNEN 1 isoform X3 | ||||
STRING | Gorai.001G091900.1 | 8e-37 | (Gossypium raimondii) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM7967 | 13 | 40 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G26870.1 | 5e-25 | NAC family protein |
Publications ? help Back to Top | |||
---|---|---|---|
|