PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cotton_A_34222_BGI-A2_v1.0
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family NAC
Protein Properties Length: 78aa    MW: 9527.91 Da    PI: 6.8046
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cotton_A_34222_BGI-A2_v1.0genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM62.21.6e-191968252
                         NAM  2 ppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvk 52
                                 pGfrFhPtdeelv +yL++kve+k++++ e ik++diy+++PwdLp+ ++
  Cotton_A_34222_BGI-A2_v1.0 19 LPGFRFHPTDEELVGFYLRRKVEKKPISI-ELIKQIDIYQYDPWDLPNWLY 68
                                59***************************.89**************96443 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5100519.111878IPR003441NAC domain
SuperFamilySSF1019411.18E-181868IPR003441NAC domain
PfamPF023654.9E-92061IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 78 aa     Download sequence    Send to blast
MEDSIDDNKK KRNGEEIKLP GFRFHPTDEE LVGFYLRRKV EKKPISIELI KQIDIYQYDP  60
WDLPNWLYDT RKLHHIIT
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A5e-13964461Stress-induced transcription factor NAC1
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtPromotes periclinal root capforming cell divisions. Activates expression of its negative regulator SMB in a feedback loop for controlled switches in cell division plane. {ECO:0000269|PubMed:19081078}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Repressed by SMB in oriented-divised root cap stem cells. {ECO:0000269|PubMed:19081078}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_017610401.17e-39PREDICTED: protein FEZ-like isoform X3
RefseqXP_017629011.13e-39PREDICTED: transcription factor JUNGBRUNNEN 1-like
SwissprotQ9ZVH02e-22FEZ_ARATH; Protein FEZ
TrEMBLA0A1U8KNI32e-37A0A1U8KNI3_GOSHI; protein FEZ isoform X4
TrEMBLA0A1U8KTF02e-37A0A1U8KTF0_GOSHI; transcription factor JUNGBRUNNEN 1 isoform X3
STRINGGorai.001G091900.18e-37(Gossypium raimondii)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM79671340
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G26870.15e-25NAC family protein
Publications ? help Back to Top
  1. Bennett T,van den Toorn A,Willemsen V,Scheres B
    Precise control of plant stem cell activity through parallel regulatory inputs.
    Development, 2014. 141(21): p. 4055-64
    [PMID:25256342]