PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Cotton_A_29306_BGI-A2_v1.0 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
|
||||||||
Family | NF-YB | ||||||||
Protein Properties | Length: 131aa MW: 14816.2 Da PI: 9.7149 | ||||||||
Description | NF-YB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NF-YB | 140.9 | 3.1e-44 | 4 | 94 | 3 | 93 |
NF-YB 3 eqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvyl 87 eqd +lPianv+rimk++lP ak+sk+aket+qecv+efisfvts+asdkc++e rkti gdd++ al+ +G+++y+e++ yl Cotton_A_29306_BGI-A2_v1.0 4 EQDPLLPIANVGRIMKRILPPTAKVSKEAKETMQECVTEFISFVTSDASDKCRKESRKTIYGDDICRALGAVGLDNYAEAIVRYL 88 89*********************************************************************************** PP NF-YB 88 kkyrel 93 +kyr + Cotton_A_29306_BGI-A2_v1.0 89 HKYRVA 94 ****76 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:1.10.20.10 | 5.7E-43 | 3 | 112 | IPR009072 | Histone-fold |
SuperFamily | SSF47113 | 3.26E-34 | 5 | 105 | IPR009072 | Histone-fold |
Pfam | PF00808 | 8.5E-25 | 9 | 72 | IPR003958 | Transcription factor CBF/NF-Y/archaeal histone domain |
PRINTS | PR00615 | 1.3E-12 | 36 | 54 | No hit | No description |
PRINTS | PR00615 | 1.3E-12 | 55 | 73 | No hit | No description |
PRINTS | PR00615 | 1.3E-12 | 74 | 92 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0046982 | Molecular Function | protein heterodimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 131 aa Download sequence Send to blast |
MGDEQDPLLP IANVGRIMKR ILPPTAKVSK EAKETMQECV TEFISFVTSD ASDKCRKESR 60 KTIYGDDICR ALGAVGLDNY AEAIVRYLHK YRVAALNQHK ATTSSFEDKM KNRIEVASHL 120 IKRMKLQLNK S |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
4g91_B | 1e-37 | 4 | 92 | 3 | 91 | Transcription factor HapC (Eurofung) |
4g92_B | 1e-37 | 4 | 92 | 3 | 91 | Transcription factor HapC (Eurofung) |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Component of the NF-Y/HAP transcription factor complex. The NF-Y complex stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_017628765.1 | 2e-94 | PREDICTED: nuclear transcription factor Y subunit B-5-like | ||||
Swissprot | O82248 | 3e-44 | NFYB5_ARATH; Nuclear transcription factor Y subunit B-5 | ||||
TrEMBL | A0A2P5X224 | 3e-92 | A0A2P5X224_GOSBA; Uncharacterized protein | ||||
STRING | Gorai.007G298300.1 | 9e-68 | (Gossypium raimondii) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM255 | 28 | 229 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT2G47810.1 | 1e-46 | nuclear factor Y, subunit B5 |
Publications ? help Back to Top | |||
---|---|---|---|
|