PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Cotton_A_28834_BGI-A2_v1.0 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
|
||||||||
Family | NAC | ||||||||
Protein Properties | Length: 61aa MW: 7007.19 Da PI: 10.3287 | ||||||||
Description | NAC family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NAM | 26 | 2.5e-08 | 3 | 39 | 91 | 128 |
NAM 91 evlskkgelvglkktLvfykgrapkgektdWvmheyrl 128 ++++ +++++g +k +vf + +++g+k +W+mhe++l Cotton_A_28834_BGI-A2_v1.0 3 PIMC-GKKKIGNRKLFVFKVKGSNEGRKGHWLMHEFSL 39 6788.8999**********9999*************97 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS51005 | 11.71 | 1 | 61 | IPR003441 | NAC domain |
SuperFamily | SSF101941 | 1.1E-9 | 3 | 46 | IPR003441 | NAC domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 61 aa Download sequence Send to blast |
MDPIMCGKKK IGNRKLFVFK VKGSNEGRKG HWLMHEFSLV DHHDEQVGSL FHPSPILSKS 60 F |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_017639771.1 | 2e-19 | PREDICTED: NAC domain-containing protein 41-like | ||||
TrEMBL | A0A1U8HWE1 | 8e-18 | A0A1U8HWE1_GOSHI; NAC domain-containing protein 41-like | ||||
STRING | Gorai.010G251100.1 | 7e-18 | (Gossypium raimondii) |