PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Cotton_A_25817_BGI-A2_v1.0 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
|
||||||||
Family | bZIP | ||||||||
Protein Properties | Length: 179aa MW: 20661.1 Da PI: 6.7248 | ||||||||
Description | bZIP family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | bZIP_1 | 51 | 3.1e-16 | 82 | 140 | 5 | 63 |
CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS bZIP_1 5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklksev 63 +++rr+++NRe+ArrsR RK+ ++eL v L +eN++L+++l++ ++ +k+ +e+ Cotton_A_25817_BGI-A2_v1.0 82 RKQRRMISNRESARRSRMRKQRHLDELWAQVVWLRNENHQLIDKLNHVSESHDKVLQEN 140 689*************************************************9999988 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SMART | SM00338 | 7.7E-16 | 78 | 142 | IPR004827 | Basic-leucine zipper domain |
PROSITE profile | PS50217 | 10.346 | 80 | 143 | IPR004827 | Basic-leucine zipper domain |
Pfam | PF00170 | 4.8E-14 | 82 | 140 | IPR004827 | Basic-leucine zipper domain |
SuperFamily | SSF57959 | 1.63E-13 | 82 | 132 | No hit | No description |
Gene3D | G3DSA:1.20.5.170 | 1.2E-12 | 82 | 154 | No hit | No description |
CDD | cd14702 | 3.16E-19 | 83 | 134 | No hit | No description |
PROSITE pattern | PS00036 | 0 | 85 | 100 | IPR004827 | Basic-leucine zipper domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 179 aa Download sequence Send to blast |
MQPSEVSGIQ YLVPSNPSPY SPHFSMNQSN KPALDSNQFL NPLYNFYIPP QIQDISPHSS 60 CISSNSTSDE ADEQQLSLII ERKQRRMISN RESARRSRMR KQRHLDELWA QVVWLRNENH 120 QLIDKLNHVS ESHDKVLQEN TQLKEEASEL RQMLFGMRLG HPNSTSVKVD DVALEHGLS |
Nucleic Localization Signal ? help Back to Top | |||
---|---|---|---|
No. | Start | End | Sequence |
1 | 94 | 101 | RRSRMRKQ |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Probable transcription factor involved in somatic embryogenesis. Acts as positive regulator of BHLH109. {ECO:0000269|PubMed:26973252}. |
Binding Motif ? help Back to Top | |||
---|---|---|---|
Motif ID | Method | Source | Motif file |
MP00647 | PBM | Transfer from LOC_Os02g49560 | Download |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_016746518.1 | 1e-130 | PREDICTED: basic leucine zipper 43-like | ||||
Refseq | XP_017640760.1 | 1e-130 | PREDICTED: basic leucine zipper 43 | ||||
Swissprot | Q9FMC2 | 3e-40 | BZP43_ARATH; Basic leucine zipper 43 | ||||
TrEMBL | A0A1U8P893 | 1e-128 | A0A1U8P893_GOSHI; basic leucine zipper 43-like | ||||
TrEMBL | A0A2P5YTZ1 | 1e-128 | A0A2P5YTZ1_GOSBA; Uncharacterized protein | ||||
STRING | Gorai.001G205800.1 | 1e-118 | (Gossypium raimondii) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM3112 | 26 | 67 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT3G30530.1 | 2e-44 | basic leucine-zipper 42 |
Publications ? help Back to Top | |||
---|---|---|---|
|