PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Cotton_A_23798_BGI-A2_v1.0 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
|
||||||||
Family | TALE | ||||||||
Protein Properties | Length: 158aa MW: 18304.7 Da PI: 9.0935 | ||||||||
Description | TALE family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Homeobox | 29.9 | 9.3e-10 | 101 | 135 | 21 | 55 |
HSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHH CS Homeobox 21 knrypsaeereeLAkklgLterqVkvWFqNrRake 55 k +yp+++++ LA+++gL+++q+ +WF N+R ++ Cotton_A_23798_BGI-A2_v1.0 101 KWPYPTEADKLALAESTGLDQKQINNWFINQRKRH 135 679*****************************985 PP | |||||||
2 | ELK | 27.4 | 7.5e-10 | 56 | 76 | 2 | 22 |
ELK 2 LKhqLlrKYsgyLgsLkqEFs 22 LK++Llr ++++++sLk EFs Cotton_A_23798_BGI-A2_v1.0 56 LKDRLLRRFGSHISSLKLEFS 76 9*******************8 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS51213 | 8.748 | 55 | 75 | IPR005539 | ELK domain |
SMART | SM01188 | 2.1E-4 | 55 | 76 | IPR005539 | ELK domain |
Pfam | PF03789 | 3.4E-7 | 56 | 76 | IPR005539 | ELK domain |
PROSITE profile | PS50071 | 12.795 | 75 | 138 | IPR001356 | Homeobox domain |
SuperFamily | SSF46689 | 9.41E-20 | 76 | 149 | IPR009057 | Homeodomain-like |
SMART | SM00389 | 4.0E-13 | 77 | 142 | IPR001356 | Homeobox domain |
Gene3D | G3DSA:1.10.10.60 | 7.8E-28 | 80 | 139 | IPR009057 | Homeodomain-like |
CDD | cd00086 | 4.63E-12 | 84 | 139 | No hit | No description |
Pfam | PF05920 | 1.5E-17 | 95 | 134 | IPR008422 | Homeobox KN domain |
PROSITE pattern | PS00027 | 0 | 113 | 136 | IPR017970 | Homeobox, conserved site |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 158 aa Download sequence Send to blast |
MRFPSRSIPL LEFQVRVMGC SVRDQLDEGG VSSDEDISGG EVEGQEGQGK SEDRGLKDRL 60 LRRFGSHISS LKLEFSKKKK KGKLPREARQ TLLEWWNVHY KWPYPTEADK LALAESTGLD 120 QKQINNWFIN QRKRHWKPSE SMQFAVMDNL SGQFFSED |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Plays a role in meristem function. Contributes to the shoot apical meristem (SAM) maintenance and organ separation by controlling boundary establishment in embryo in a CUC1, CUC2 and STM-dependent manner. Involved in maintaining cells in an undifferentiated, meristematic state. Probably binds to the DNA sequence 5'-TGAC-3'. {ECO:0000269|PubMed:16798887}. |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Seems to be repressed by AS2 and AS1 but induced by STM, CUC1 and CUC2. {ECO:0000269|PubMed:11311158, ECO:0000269|PubMed:16798887}. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_017632201.1 | 6e-89 | PREDICTED: homeobox protein knotted-1-like 6 | ||||
Swissprot | Q84JS6 | 4e-64 | KNAT6_ARATH; Homeobox protein knotted-1-like 6 | ||||
TrEMBL | A0A0B0NTB3 | 3e-91 | A0A0B0NTB3_GOSAR; Homeobox protein knotted-1-like 6 | ||||
STRING | Gorai.005G180500.1 | 5e-88 | (Gossypium raimondii) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM835 | 27 | 85 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G23380.2 | 2e-53 | KNOTTED1-like homeobox gene 6 |
Publications ? help Back to Top | |||
---|---|---|---|
|