PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Cotton_A_23436_BGI-A2_v1.0 | ||||||||
Common Name | F383_14662, MYB109 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
|
||||||||
Family | MYB | ||||||||
Protein Properties | Length: 219aa MW: 25322.6 Da PI: 8.0238 | ||||||||
Description | MYB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 55.3 | 1.6e-17 | 13 | 60 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 +g W eEd+ll+d+v+ +G+g+W++Ia++ g++R++k+c++rw +yl Cotton_A_23436_BGI-A2_v1.0 13 KGLWAMEEDKLLIDYVNVHGKGQWNKIANRTGLKRSGKSCRLRWMNYL 60 577999****************************************97 PP | |||||||
2 | Myb_DNA-binding | 58.1 | 2e-18 | 66 | 111 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 +g +++eE++l ++++k+lG++ W++Ia++++ gRt++q+k++w+++l Cotton_A_23436_BGI-A2_v1.0 66 KGDFSEEEEDLVIRLHKLLGNR-WSLIAKRVP-GRTDNQVKNYWNSHL 111 689*******************.*********.************986 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS51294 | 15.142 | 1 | 60 | IPR017930 | Myb domain |
SMART | SM00717 | 1.7E-13 | 12 | 62 | IPR001005 | SANT/Myb domain |
SuperFamily | SSF46689 | 4.39E-30 | 12 | 107 | IPR009057 | Homeodomain-like |
Pfam | PF00249 | 2.8E-16 | 13 | 60 | IPR001005 | SANT/Myb domain |
Gene3D | G3DSA:1.10.10.60 | 1.2E-22 | 14 | 67 | IPR009057 | Homeodomain-like |
CDD | cd00167 | 1.50E-10 | 19 | 60 | No hit | No description |
PROSITE profile | PS51294 | 28.767 | 61 | 115 | IPR017930 | Myb domain |
SMART | SM00717 | 1.7E-18 | 65 | 113 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 1.4E-17 | 66 | 111 | IPR001005 | SANT/Myb domain |
Gene3D | G3DSA:1.10.10.60 | 3.1E-27 | 68 | 115 | IPR009057 | Homeodomain-like |
CDD | cd00167 | 5.57E-13 | 69 | 111 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0045893 | Biological Process | positive regulation of transcription, DNA-templated | ||||
GO:0048765 | Biological Process | root hair cell differentiation | ||||
GO:0090377 | Biological Process | seed trichome initiation | ||||
GO:0090378 | Biological Process | seed trichome elongation | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 219 aa Download sequence Send to blast |
MSMKKEGEIL YKKGLWAMEE DKLLIDYVNV HGKGQWNKIA NRTGLKRSGK SCRLRWMNYL 60 SPNVKKGDFS EEEEDLVIRL HKLLGNRWSL IAKRVPGRTD NQVKNYWNSH LRKKLGIIDQ 120 NKTRIDFCQS SKQVKVCHVD EAATDPSPGH GTTTETTGIT VDQSNQQEVI DHRVLNNTTQ 180 ESMTTESYIN TFWIPDHDYE LSTLAMIDHF HECSSFHLS |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1a5j_A | 6e-29 | 13 | 115 | 7 | 108 | B-MYB |
1h8a_C | 6e-29 | 13 | 115 | 27 | 128 | MYB TRANSFORMING PROTEIN |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription activator, when associated with BHLH2/EGL3/MYC146 or BHLH12/MYC1. Involved in epidermal cell fate specification in roots and hypocotyl. Together with GL3 or BHLH2, promotes the formation of non-hair developing cells (atrichoblasts) et the N position in root epidermis. Regulates stomata spatial distribution in hypocotyls. Binds to the WER-binding sites (WBS) promoter regions and activates the transcription of target genes such as GL2 and of CPC. {ECO:0000269|PubMed:10589676, ECO:0000269|PubMed:11585796, ECO:0000269|PubMed:14627722, ECO:0000269|PubMed:15361138, ECO:0000269|PubMed:15795220, ECO:0000269|PubMed:16207757}. |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Transcriptional activation correlates with reduced histone acetylation on H3 and H4 mediated by HDA18 in N cells. Repressed by CPC in hair cells (H position). {ECO:0000269|PubMed:11910008, ECO:0000269|PubMed:16176989}. |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AY633559 | 0.0 | AY633559.1 Gossypium arboreum myb family transcription factor 109 (MYB109) mRNA, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | NP_001316946.1 | 1e-165 | transcription factor WER | ||||
Swissprot | Q9SEI0 | 7e-72 | WER_ARATH; Transcription factor WER | ||||
TrEMBL | Q6GVK7 | 1e-164 | Q6GVK7_GOSAR; Myb family transcription factor 109 | ||||
STRING | Gorai.012G061800.1 | 1e-148 | (Gossypium raimondii) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM4 | 28 | 2646 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G14750.1 | 3e-74 | myb domain protein 66 |