PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cotton_A_22592_BGI-A2_v1.0
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family STAT
Protein Properties Length: 710aa    MW: 79527.9 Da    PI: 5.5581
Description STAT family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cotton_A_22592_BGI-A2_v1.0genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1STAT175.77.4e-552173391122
                        STAT   1 ldvvllnalgqpvekdvevvasLlyadsglvveksddaeapLLisydGvefssedrplkllrGrasfklkisq.LsskcdnrL 82 
                                 ldvvlln++gqpv+k++evvasLlya + l+vek++d+e+pLL+s+dG+ef+s drp+kl +Grasfklkis+ Lsskcdnr 
  Cotton_A_22592_BGI-A2_v1.0 217 LDVVLLNTFGQPVNKELEVVASLLYAHNRLPVEKTNDEEPPLLASCDGIEFASCDRPCKLSKGRASFKLKISKvLSSKCDNRQ 299
                                 8***********************************************************************868******** PP

                        STAT  83 frikfeipklkkypfleavskpirCisrsrntrsssltkk 122
                                 f+ikf + kl+ y+fle +s +irCisr+r+ r+s+ ++k
  Cotton_A_22592_BGI-A2_v1.0 300 FCIKFGVSKLEGYRFLEDFSPSIRCISRNRTPRTSTIIWK 339
                                 **********************************999886 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
CDDcd103389.89E-55593699No hitNo description
Gene3DG3DSA:3.30.505.105.4E-7597685IPR000980SH2 domain
SuperFamilySSF555501.65E-8600670IPR000980SH2 domain
PROSITE profilePS500019.767604688IPR000980SH2 domain
Sequence ? help Back to Top
Protein Sequence    Length: 710 aa     Download sequence    Send to blast
MGQNNQIIGE DDYILLKDFE VETEVDEEKG FILCFWVYIF NSNAFPSTIL KQVYAETNSS  60
PPLLVLNEKT LMIFPLTCLL NEALGPGNTD FPSEDPKVSA EIEHPQNNWI HVGYEGGFGA  120
AVRCGAFSLL FVSRYSIVTV SSDFVRLYIN GEIAGELHLS SLSNDNSMPN GSRKRTLFGI  180
TGDSNLQGFI HDAKVLPSTL SIKEQYVKAS CRRIFSLDVV LLNTFGQPVN KELEVVASLL  240
YAHNRLPVEK TNDEEPPLLA SCDGIEFASC DRPCKLSKGR ASFKLKISKV LSSKCDNRQF  300
CIKFGVSKLE GYRFLEDFSP SIRCISRNRT PRTSTIIWKK VSAVHPVNGS QPFGLDDSSC  360
EPKHNTVHEA KLSPTSKRVR LGEAKISAVD QHSEECNSLA SKQNQVENGF GSRLEARPEN  420
FEEMNTSLSD SESTGARDSA LKSVSSRGHS VPDVTIFRYC LGGLTDRSLL LKEIATTVSD  480
EEISGFAEQV SLYSGCSHHR HQIKMAKRLI DEGTVAWNLI SQNNLQVQWE SAVFEIEEQF  540
MKIASCSSRS LTQQDFELLR KIAGCQEYMA QENFEKMWCW LYPVAYTLSS DWVNAMWNST  600
SPKWIEGFIT KEEAELSLQG SRGLQEPGTF ILRFPTSRSW PHPDAGNLVV TYVGTDYSLH  660
HKLLSLDNVY SSGVREKNVK VKPLQDMLLE EPELSRLGRY ETPPLEFPSA
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_017638495.10.0PREDICTED: uncharacterized protein LOC108480125
SwissprotQ56XZ10.0SHB_ARATH; SH2 domain-containing protein B
TrEMBLA0A2P5Y6810.0A0A2P5Y681_GOSBA; Uncharacterized protein
STRINGGorai.007G332400.10.0(Gossypium raimondii)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM52052645
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G78540.10.0SH2 domain protein B
Publications ? help Back to Top
  1. Yamada Y,Wang HY,Fukuzawa M,Barton GJ,Williams JG
    A new family of transcription factors.
    Development, 2008. 135(18): p. 3093-101
    [PMID:18701541]