PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Cotton_A_20149_BGI-A2_v1.0 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
|
||||||||
Family | DBB | ||||||||
Protein Properties | Length: 122aa MW: 13391.6 Da PI: 6.4666 | ||||||||
Description | DBB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | zf-B_box | 18.9 | 3.2e-06 | 4 | 46 | 5 | 41 |
zf-B_box 5 kCpeHeekelqlfCedCqqllCedClleeHkg......Htvvp 41 C+++e ++ C ++ lC +C ++ H H++ p Cotton_A_20149_BGI-A2_v1.0 4 QCNLCEAAVAKVLCCADEAALCLECDEKVHAAnklvseHQRLP 46 7*****************************6678888888776 PP | |||||||
2 | zf-B_box | 25.2 | 3.3e-08 | 54 | 87 | 2 | 35 |
zf-B_box 2 eerkCpeHeekelqlfCedCqqllCedClleeHk 35 +++kC+ ++e +fC +++ llC++C +++H Cotton_A_20149_BGI-A2_v1.0 54 QMPKCDICQEISGFFFCLQDRALLCRKCDVAIHT 87 789*******889*******************93 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS50119 | 10.196 | 1 | 47 | IPR000315 | B-box-type zinc finger |
CDD | cd00021 | 3.27E-5 | 3 | 47 | No hit | No description |
SMART | SM00336 | 9.6E-8 | 4 | 47 | IPR000315 | B-box-type zinc finger |
SMART | SM00336 | 9.1E-12 | 53 | 100 | IPR000315 | B-box-type zinc finger |
Pfam | PF00643 | 1.2E-5 | 54 | 87 | IPR000315 | B-box-type zinc finger |
CDD | cd00021 | 3.82E-5 | 56 | 87 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0005622 | Cellular Component | intracellular | ||||
GO:0008270 | Molecular Function | zinc ion binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 122 aa Download sequence Send to blast |
MRIQCNLCEA AVAKVLCCAD EAALCLECDE KVHAANKLVS EHQRLPLFSS SSFQMPKCDI 60 CQEISGFFFC LQDRALLCRK CDVAIHTVNS VVSCHQRFLL TGVEVDVGTK TDTIGASCFN 120 AK |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Acts as positive regulator of seedling photomorphogenesis and light-regulated inhibition of hypocotyl elongation, independently and in concert with HY5 and BBX21 (PubMed:18540109, PubMed:18796637, PubMed:18182030, PubMed:21427283). Acts as a positive regulator of de-etiolation and influences chloroplast biogenesis and function through regulation of genes encoding chloroplast proteins (PubMed:18182030). Acts downstream of COP1 and plays an important role in early and long-term adjustment of the shade avoidance syndrome (SAS) responses in natural environments (PubMed:21070414). Regulates the expression of genes responsive to light hormone signals which may contribute to optimal seedling development (PubMed:21427283). {ECO:0000269|PubMed:18182030, ECO:0000269|PubMed:18540109, ECO:0000269|PubMed:18796637, ECO:0000269|PubMed:21070414, ECO:0000269|PubMed:21427283}. |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: By light. {ECO:0000269|PubMed:18182030}. |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | JX590258 | 1e-100 | JX590258.1 Gossypium hirsutum clone NBRI_GE25138 microsatellite sequence. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_012477061.1 | 3e-84 | PREDICTED: B-box zinc finger protein 22-like | ||||
Refseq | XP_016690944.1 | 3e-84 | PREDICTED: B-box zinc finger protein 22-like | ||||
Refseq | XP_017625877.1 | 3e-84 | PREDICTED: B-box zinc finger protein 22-like | ||||
Swissprot | Q9SYM2 | 9e-55 | BBX22_ARATH; B-box zinc finger protein 22 | ||||
TrEMBL | A0A0D2R519 | 7e-83 | A0A0D2R519_GOSRA; Uncharacterized protein | ||||
TrEMBL | A0A1U8JRL0 | 7e-83 | A0A1U8JRL0_GOSHI; B-box zinc finger protein 22-like | ||||
TrEMBL | A0A2P5WF99 | 7e-83 | A0A2P5WF99_GOSBA; Uncharacterized protein | ||||
STRING | Gorai.004G271600.1 | 1e-83 | (Gossypium raimondii) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM12502 | 24 | 30 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G78600.1 | 6e-43 | light-regulated zinc finger protein 1 |