PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Cotton_A_19792_BGI-A2_v1.0 | ||||||||
Common Name | F383_03320 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
|
||||||||
Family | DBB | ||||||||
Protein Properties | Length: 238aa MW: 26206.8 Da PI: 4.7704 | ||||||||
Description | DBB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | zf-B_box | 21.3 | 5.5e-07 | 4 | 44 | 5 | 39 |
zf-B_box 5 kCpeHeekelqlfCedCqqllCedClleeHkg......Htv 39 C+ +e+ +++ C ++ lC++C e H H++ Cotton_A_19792_BGI-A2_v1.0 4 QCDVCERAPATVICCADEAALCAKCDIEVHAAnklaskHQR 44 7*****************************65667777765 PP | |||||||
2 | zf-B_box | 26.7 | 1.2e-08 | 53 | 85 | 2 | 34 |
zf-B_box 2 eerkCpeHeekelqlfCedCqqllCedClleeH 34 + + C+ ++ek + +fC +++ l+C+dC + +H Cotton_A_19792_BGI-A2_v1.0 53 KLPPCDICQEKAAFIFCVEDRALFCRDCDEPIH 85 6789**************************999 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS50119 | 9.3 | 1 | 47 | IPR000315 | B-box-type zinc finger |
CDD | cd00021 | 1.28E-6 | 3 | 47 | No hit | No description |
Pfam | PF00643 | 2.8E-5 | 4 | 44 | IPR000315 | B-box-type zinc finger |
SMART | SM00336 | 1.5E-9 | 4 | 47 | IPR000315 | B-box-type zinc finger |
PROSITE profile | PS50119 | 9.044 | 52 | 99 | IPR000315 | B-box-type zinc finger |
SMART | SM00336 | 1.3E-14 | 52 | 99 | IPR000315 | B-box-type zinc finger |
Pfam | PF00643 | 1.4E-6 | 53 | 94 | IPR000315 | B-box-type zinc finger |
CDD | cd00021 | 2.10E-7 | 55 | 98 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0009640 | Biological Process | photomorphogenesis | ||||
GO:0009651 | Biological Process | response to salt stress | ||||
GO:0048573 | Biological Process | photoperiodism, flowering | ||||
GO:0080167 | Biological Process | response to karrikin | ||||
GO:0090351 | Biological Process | seedling development | ||||
GO:1902448 | Biological Process | positive regulation of shade avoidance | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003712 | Molecular Function | transcription cofactor activity | ||||
GO:0008270 | Molecular Function | zinc ion binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 238 aa Download sequence Send to blast |
MKIQCDVCER APATVICCAD EAALCAKCDI EVHAANKLAS KHQRLLLQCL SNKLPPCDIC 60 QEKAAFIFCV EDRALFCRDC DEPIHPAGSL AANHQRFLAT GIRVALSSSC NKNTENNVLE 120 PPNKSAPQTS MKMPAHQQHS SFSSPWAVDD LLELSDIQSL NKKEHSELGE LEWLADIGLF 180 GDQLPQEALA AAEVPQLPIS QSSSTNLYRP TKYSMALKKP RIETPDEDDE FFTVPDLG |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Acts as negative regulator of seedling photomorphogenesis and light-regulated inhibition of hypocotyl elongation (PubMed:17605755, PubMed:18540109, PubMed:21685177). BBX24/STO and BBX25/STH function as transcriptional corepressors of HY5 activity, leading to the down-regulation of BBX22 expression. BBX24/STO acts additively with BBX25/STH during de-etiolation and the hypocotyl shade avoidance response (PubMed:23624715). Functions as negative regulator of photomorphogenic UV-B responses by interacting with both COP1 and HY5 (PubMed:22410790). May act as a transcription factor in the salt-stress response (PubMed:12909688). {ECO:0000269|PubMed:12909688, ECO:0000269|PubMed:17605755, ECO:0000269|PubMed:18540109, ECO:0000269|PubMed:21685177, ECO:0000269|PubMed:22410790, ECO:0000269|PubMed:23624715}. |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Circadian regulation with a peak before dawn. {ECO:0000269|PubMed:17605755}. |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | HQ524755 | 0.0 | HQ524755.1 Gossypium herbaceum clone NBRI_A2_3787-1 simple sequence repeat marker, mRNA sequence. | |||
GenBank | HQ525521 | 0.0 | HQ525521.1 Gossypium herbaceum clone NBRI_A2_3787-2 simple sequence repeat marker, mRNA sequence. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_012487043.1 | 1e-176 | PREDICTED: B-box zinc finger protein 24-like | ||||
Refseq | XP_016670516.1 | 1e-176 | PREDICTED: B-box zinc finger protein 24-like | ||||
Refseq | XP_016748117.1 | 1e-176 | PREDICTED: B-box zinc finger protein 24-like | ||||
Refseq | XP_017610998.1 | 1e-176 | PREDICTED: B-box zinc finger protein 24-like | ||||
Swissprot | Q96288 | 2e-97 | BBX24_ARATH; B-box zinc finger protein 24 | ||||
TrEMBL | A0A0B0NVU9 | 1e-174 | A0A0B0NVU9_GOSAR; Salt tolerance-like protein | ||||
TrEMBL | A0A0D2T2Y8 | 1e-174 | A0A0D2T2Y8_GOSRA; Uncharacterized protein | ||||
TrEMBL | A0A1U8PA90 | 1e-174 | A0A1U8PA90_GOSHI; B-box zinc finger protein 24-like | ||||
TrEMBL | A0A2P5XE52 | 1e-171 | A0A2P5XE52_GOSBA; Uncharacterized protein | ||||
STRING | Gorai.006G229300.1 | 1e-175 | (Gossypium raimondii) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM2711 | 27 | 67 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G06040.1 | 1e-100 | DBB family protein |
Publications ? help Back to Top | |||
---|---|---|---|
|