PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Cotton_A_16018_BGI-A2_v1.0 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
|
||||||||
Family | NF-YA | ||||||||
Protein Properties | Length: 175aa MW: 19342.1 Da PI: 10.7185 | ||||||||
Description | NF-YA family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | CBFB_NFYA | 84.6 | 1.6e-26 | 59 | 115 | 1 | 58 |
CBFB_NFYA 1 deplYVNaKQyqrIlkRRqkRakleeekkldeksrkpylheSRhkhAlrRpRgsgGrF 58 d p+YVNa+Qy++I++RR Rak++ e+k+ +k+rkpylh SRh hA+r pRg+gG F Cotton_A_16018_BGI-A2_v1.0 59 DGPIYVNARQYNGIIRRRRYRAKAALETKV-TKARKPYLHYSRHLHAVRHPRGNGGLF 115 57****************************.*************************87 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SMART | SM00521 | 5.8E-28 | 57 | 118 | IPR001289 | Nuclear transcription factor Y subunit A |
PROSITE profile | PS51152 | 30.508 | 58 | 118 | IPR001289 | Nuclear transcription factor Y subunit A |
PRINTS | PR00616 | 3.3E-18 | 61 | 83 | IPR001289 | Nuclear transcription factor Y subunit A |
Pfam | PF02045 | 1.3E-22 | 61 | 115 | IPR001289 | Nuclear transcription factor Y subunit A |
PRINTS | PR00616 | 3.3E-18 | 92 | 115 | IPR001289 | Nuclear transcription factor Y subunit A |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 175 aa Download sequence Send to blast |
MLKAIISRQQ SLQSEHGLGQ PMVCAKYPYL MDQGYGVLPT FGPQISGRVM LPLNLATEDG 60 PIYVNARQYN GIIRRRRYRA KAALETKVTK ARKPYLHYSR HLHAVRHPRG NGGLFLNTKS 120 SNTGKDGMQM MKANEGQLSR LTGSQISQVL QSDSGTINSY KEPNGGGSTF SGSER |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
4awl_A | 2e-14 | 59 | 123 | 2 | 66 | NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT ALPHA |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. {ECO:0000250}. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_016700003.1 | 1e-125 | PREDICTED: nuclear transcription factor Y subunit A-10-like | ||||
Refseq | XP_016702219.1 | 1e-125 | PREDICTED: nuclear transcription factor Y subunit A-10-like | ||||
Swissprot | Q8LFU0 | 1e-40 | NFYAA_ARATH; Nuclear transcription factor Y subunit A-10 | ||||
TrEMBL | A0A1U8KNC4 | 1e-124 | A0A1U8KNC4_GOSHI; nuclear transcription factor Y subunit A-10-like | ||||
TrEMBL | A0A2P5WAM1 | 1e-121 | A0A2P5WAM1_GOSBA; Uncharacterized protein | ||||
STRING | Gorai.009G394400.1 | 1e-101 | (Gossypium raimondii) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM3008 | 27 | 67 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G06510.3 | 1e-37 | nuclear factor Y, subunit A10 |
Publications ? help Back to Top | |||
---|---|---|---|
|