PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cotton_A_14407_BGI-A2_v1.0
Common NameF383_08457
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family ARF
Protein Properties Length: 691aa    MW: 76963.1 Da    PI: 6.4322
Description ARF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cotton_A_14407_BGI-A2_v1.0genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B371.88.8e-23129229198
                                 EEEE-..-HHHHTT-EE--HHH.HTT......---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT CS
                          B3   1 ffkvltpsdvlksgrlvlpkkfaeeh......ggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkeg 77 
                                 f k+lt sd++++g +++ +k+a+e+      ++ ++ +++l+ +d++g +W++k+i+r++++r++lt+GW+ Fv +++L +g
  Cotton_A_14407_BGI-A2_v1.0 129 FSKILTASDTSTHGGFSVLRKHATEClppldmNLATP-TQELVAKDLHGYEWRFKHIFRGQPRRHLLTTGWSTFVTSKRLVAG 210
                                 889***************************9744444.459****************************************** PP

                                 -EEEEEE-SSSEE..EEEEE- CS
                          B3  78 DfvvFkldgrsefelvvkvfr 98 
                                 D +vF   + +++el+v+v+r
  Cotton_A_14407_BGI-A2_v1.0 211 DAFVFL--RGDNGELRVGVRR 229
                                 ******..3489999****98 PP

2Auxin_resp103.72.3e-34255334183
                  Auxin_resp   1 aahaastksvFevvYnPrastseFvvkvekvekalkvkvsvGmRfkmafetedsserrlsGtvvgvsdldpvrWpnSkWrsLk 83 
                                 aaha++t++ F v+Y+P+  ts+F++ v+k+++a+++ +svGmRfkm+fe+eds+err++Gt+vgv d++p +W++SkWrsLk
  Cotton_A_14407_BGI-A2_v1.0 255 AAHAVTTHTLFVVYYKPS--TSQFIIGVNKYLEAINNGFSVGMRFKMRFEGEDSPERRFTGTIVGVGDISP-HWSESKWRSLK 334
                                 79***************8..59***********************************************99.*********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019362.49E-39114258IPR015300DNA-binding pseudobarrel domain
Gene3DG3DSA:2.40.330.102.5E-39121244IPR015300DNA-binding pseudobarrel domain
CDDcd100171.43E-20127229No hitNo description
PfamPF023621.0E-20129229IPR003340B3 DNA binding domain
SMARTSM010199.3E-22129231IPR003340B3 DNA binding domain
PROSITE profilePS5086312.28129231IPR003340B3 DNA binding domain
PfamPF065071.1E-31255334IPR010525Auxin response factor
PfamPF023096.6E-8559613IPR033389AUX/IAA domain
SuperFamilySSF542771.11E-12575653No hitNo description
PROSITE profilePS5174526.42577669IPR000270PB1 domain
PfamPF023094.2E-6618665IPR033389AUX/IAA domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009734Biological Processauxin-activated signaling pathway
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 691 aa     Download sequence    Send to blast
MAHLEGNQRG SSTAHAVSGS AGDDLYQELW KLCAGPLVEI PRVHERVFYF PQGHMEQLEA  60
STNQELSNQT PLFNLPSKIL CRVLHVELLA EQETDEVYAQ ITLQPEDQSE PTSLDPFPTE  120
APKRTVHSFS KILTASDTST HGGFSVLRKH ATECLPPLDM NLATPTQELV AKDLHGYEWR  180
FKHIFRGQPR RHLLTTGWST FVTSKRLVAG DAFVFLRGDN GELRVGVRRL ARQQSTMPSS  240
VISSQSMHLG VLATAAHAVT THTLFVVYYK PSTSQFIIGV NKYLEAINNG FSVGMRFKMR  300
FEGEDSPERR FTGTIVGVGD ISPHWSESKW RSLKIQWDEP AAIQRPERVS PWEIEPFVDS  360
ASANLQPTIM CKRPRPVDIP ASEITTGSAG SAFWCRESIQ SHELTPVGST LEVQSSENQV  420
MCPMRQKEAD DCLINGNGGY KSRTPPENAW PPSPLVNVSL NLFPDSMENN YKTGALQTAL  480
TGYAKSLMHD QVVKRKTETF TGCRLFGFNL TDSTSVAAPP DKEQMSTSID YNGVRGPIPA  540
AFHVEQKPET SKEQKQVASE TSTQEMQAKQ GSATSMRSRT KVHMQGIAVG RAVDLTALKG  600
YNDLINELEK MFEIKGELCR SGQWSIVFTD DEGDMMLVGD DPWVEFCKMV RKIFIYSSEE  660
VKKISTRCKF PAASMECEGT VVSLDSEHRS V
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4ldv_A1e-1681935713355Auxin response factor 1
4ldw_A1e-1681935713355Auxin response factor 1
4ldw_B1e-1681935713355Auxin response factor 1
4ldx_A1e-1681935713355Auxin response factor 1
4ldx_B1e-1681935713355Auxin response factor 1
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1371375KRPRP
Functional Description ? help Back to Top
Source Description
UniProtAuxin response factors (ARFs) are transcriptional factors that bind specifically to the DNA sequence 5'-TGTCTC-3' found in the auxin-responsive promoter elements (AuxREs). Could act as transcriptional activator or repressor. Formation of heterodimers with Aux/IAA proteins may alter their ability to modulate early auxin response genes expression. {ECO:0000269|PubMed:12036261}.
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAJ5670006e-40AJ567000.1 Gossypium hirsutum microsatellite DNA mGhCIR051, clone CIR051.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_017630994.10.0PREDICTED: auxin response factor 18-like isoform X2
SwissprotQ9C5W90.0ARFR_ARATH; Auxin response factor 18
TrEMBLA0A0B0P0R20.0A0A0B0P0R2_GOSAR; Auxin response factor
STRINGGorai.007G109500.10.0(Gossypium raimondii)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM27642762
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G61830.10.0auxin response factor 18
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Wójcikowska B,Gaj MD
    Expression profiling of AUXIN RESPONSE FACTOR genes during somatic embryogenesis induction in Arabidopsis.
    Plant Cell Rep., 2017. 36(6): p. 843-858
    [PMID:28255787]