PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Cotton_A_13201_BGI-A2_v1.0 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
|
||||||||
Family | GRF | ||||||||
Protein Properties | Length: 163aa MW: 18655.8 Da PI: 9.8926 | ||||||||
Description | GRF family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | WRC | 79.1 | 4.3e-25 | 66 | 109 | 1 | 44 |
WRC 1 daepgrCrRtDGKkWRCsrrvlegkklCErHlhrgrsrsrkske 44 d+ep+rCrRtDGKkWRCsr+v +++k+CErH h++r rsrk++e Cotton_A_13201_BGI-A2_v1.0 66 DPEPWRCRRTDGKKWRCSRDVAPDQKYCERHSHKSRPRSRKPVE 109 79***************************************987 PP | |||||||
2 | QLQ | 60.5 | 4.6e-21 | 11 | 45 | 2 | 36 |
QLQ 2 aFTaaQlqlLksQilAyKyLaanqPvPpeLlqaiq 36 +FTaaQ+q+L++Q ++yKy++a++PvP+eLl +++ Cotton_A_13201_BGI-A2_v1.0 11 PFTAAQWQELERQTMIYKYMMASVPVPAELLIPLT 45 9******************************9997 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SMART | SM00951 | 3.2E-12 | 10 | 46 | IPR014978 | Glutamine-Leucine-Glutamine, QLQ |
Pfam | PF08880 | 2.7E-15 | 11 | 44 | IPR014978 | Glutamine-Leucine-Glutamine, QLQ |
PROSITE profile | PS51666 | 21.866 | 11 | 46 | IPR014978 | Glutamine-Leucine-Glutamine, QLQ |
PROSITE profile | PS51667 | 25.479 | 66 | 110 | IPR014977 | WRC domain |
Pfam | PF08879 | 1.9E-20 | 67 | 109 | IPR014977 | WRC domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0005524 | Molecular Function | ATP binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 163 aa Download sequence Send to blast |
MAAAPANARV PFTAAQWQEL ERQTMIYKYM MASVPVPAEL LIPLTKNPSN AIKGSLELGF 60 SSNSSDPEPW RCRRTDGKKW RCSRDVAPDQ KYCERHSHKS RPRSRKPVEL PNHSNININN 120 NDHKSQTLHN MASDGTTNQP HQNPHFTNHH DPHFFTSSFD QSR |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription activator that plays a role in the regulation of cell expansion in leaf and cotyledons tissues. Component of a network formed by miR396, the GRFs and their interacting factors (GIFs) acting in the regulation of meristem function, at least partially through the control of cell proliferation. {ECO:0000250}. | |||||
UniProt | Transcription activator that plays a role in the regulation of cell expansion in leaf and cotyledons tissues. Component of a network formed by miR396, the GRFs and their interacting factors (GIFs) acting in the regulation of meristem function, at least partially through the control of cell proliferation. {ECO:0000269|PubMed:12974814, ECO:0000269|PubMed:15326298, ECO:0000269|PubMed:20023165, ECO:0000269|PubMed:21036927}. |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: microRNA 396 (miR396a or miR396b) negatively regulates growth-regulating factors (GRF1-4 and GRF7-9). {ECO:0000269|PubMed:15200956, ECO:0000269|PubMed:19453503}. | |||||
UniProt | INDUCTION: microRNA 396 (miR396a or miR396b) negatively regulates growth-regulating factors (GRF1-4 and GRF7-9). {ECO:0000269|PubMed:15200956, ECO:0000269|PubMed:19453503, ECO:0000269|PubMed:20023165}. |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | DQ108541 | 5e-74 | DQ108541.1 Corchorus olitorius SSR marker J142-M13F genomic sequence. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_016732760.1 | 1e-118 | PREDICTED: growth-regulating factor 8-like isoform X3 | ||||
Swissprot | Q8L8A8 | 8e-39 | GRF2_ARATH; Growth-regulating factor 2 | ||||
Swissprot | Q9SU44 | 7e-39 | GRF8_ARATH; Growth-regulating factor 8 | ||||
TrEMBL | A0A0D2Q1X8 | 1e-117 | A0A0D2Q1X8_GOSRA; Uncharacterized protein | ||||
TrEMBL | A0A1U8N129 | 1e-117 | A0A1U8N129_GOSHI; growth-regulating factor 8-like isoform X3 | ||||
STRING | Gorai.008G259500.1 | 1e-107 | (Gossypium raimondii) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM7836 | 26 | 37 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT4G37740.1 | 2e-33 | growth-regulating factor 2 |
Publications ? help Back to Top | |||
---|---|---|---|
|