PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Home  TFext  BLAST  Prediction  Download  Help  About  Links  PlantRegMap
(e.g., LFY)
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cotton_A_08893_BGI-A2_v1.0
Organism
Gossypium arboreum
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family bZIP
Protein Properties Length: 156aa    MW: 17788.7 Da    PI: 4.9927
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cotton_A_08893_BGI-A2_v1.0genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_141.23.7e-132482563
                                CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
                      bZIP_1  5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklksev 63
                                ++ +r+++NRe+ArrsR RK++ ++ L +   +L+++N++ + +++  +++  +++se+
  Cotton_A_08893_BGI-A2_v1.0 24 RKRKRMISNRESARRSRMRKQKHLDDLMTQLTQLQKQNHEIITNINFTTQHLLNVESEN 82
                                6789***************************************9999999988888877 PP
Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003382.0E-182084IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1701.7E-102199No hitNo description
PROSITE profilePS5021710.3582285IPR004827Basic-leucine zipper domain
SuperFamilySSF579591.75E-122476No hitNo description
PfamPF001702.8E-102469IPR004827Basic-leucine zipper domain
CDDcd147025.09E-182575No hitNo description
PROSITE patternPS0003602742IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009744Biological Processresponse to sucrose
GO:0080149Biological Processsucrose induced translational repression
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 156 aa     Download sequence    Send to blast
MATSSGSSAT QINSGSEEAL MDERKRKRMI SNRESARRSR MRKQKHLDDL MTQLTQLQKQ  60
NHEIITNINF TTQHLLNVES ENSVLRAQLN ELTHRLQSLN EIISFLNDDH GDDDDDDDKT  120
SIDFTQPAVA DTAFLNPFHL AFLNQPIMAS ADNTFQ
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
12344RKRKRMISNRESARRSRMRKQK
23643RRSRMRKQ
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor that binds to the DNA G-box motif 5'-CACGTG-3' of MAN7 promoter. Involved in the positive regulation of seed germination through MAN7 gene activation. MAN7 is required for both, loosening of the micropylar endosperm, and rupture of the seed coat in germinating seeds. {ECO:0000269|PubMed:23461773}.
UniProtTranscription factor that binds to the DNA sequence 5'-ACTCAT-3' in target gene promoters. Promotes POX1/PRODH1 expression in response to hypoosmolarity stress (PubMed:15047879). Positively regulates the expression of ASN1 and POX2/PRODH2 genes, which are involved in amino acid metabolism (PubMed:18088315). Regulates several metabolic pathways such as myo-inositol, raffinose and trehalose. Regulates several trehalose metabolism genes, including TRE1, TPP5 and TPP6 (PubMed:21534971). Mediates recruitment of the histone acetylation machinery to activate auxin-induced transcription. Interacts with ADA2B adapter protein to promote ADA2B-mediated recruitment of SAGA-like histone acetyltransferase complexes to specific auxin-responsive genes (PubMed:24861440). {ECO:0000269|PubMed:15047879, ECO:0000269|PubMed:18088315, ECO:0000269|PubMed:21534971, ECO:0000269|PubMed:24861440}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00470DAPTransfer from AT4G34590Download
Motif logo
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: By light (PubMed:9620274). Induced by hypoosmolarity (PubMed:15047879). Repressed by sucrose (at protein level) (PubMed:9721683, PubMed:15208401). {ECO:0000269|PubMed:15047879, ECO:0000269|PubMed:15208401, ECO:0000269|PubMed:9620274, ECO:0000269|PubMed:9721683}.
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankJX9640384e-47JX964038.1 Gossypium hirsutum clone NBRI_TRANS-307 microsatellite sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016739306.11e-110PREDICTED: bZIP transcription factor 53-like
SwissprotC0Z2L54e-43BZP44_ARATH; bZIP transcription factor 44
SwissprotO656833e-43BZP11_ARATH; bZIP transcription factor 11
TrEMBLA0A1U8NJX21e-109A0A1U8NJX2_GOSHI; bZIP transcription factor 53-like
TrEMBLA0A2P5X5221e-109A0A2P5X522_GOSBA; Uncharacterized protein
STRINGGorai.012G155000.12e-75(Gossypium raimondii)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM50128154
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G34590.15e-39G-box binding factor 6
Publications ? help Back to Top
  1. Mair A, et al.
    SnRK1-triggered switch of bZIP63 dimerization mediates the low-energy response in plants.
    Elife, 2016.
    [PMID:26263501]
  2. Sagor GH, et al.
    A novel strategy to produce sweeter tomato fruits with high sugar contents by fruit-specific expression of a single bZIP transcription factor gene.
    Plant Biotechnol. J., 2016. 14(4): p. 1116-26
    [PMID:26402509]
  3. Walper E,Weiste C,Mueller MJ,Hamberg M,Dröge-Laser W
    Screen Identifying Arabidopsis Transcription Factors Involved in the Response to 9-Lipoxygenase-Derived Oxylipins.
    PLoS ONE, 2016. 11(4): p. e0153216
    [PMID:27073862]
  4. Wang XY, et al.
    Metabolomic analysis reveals the relationship between AZI1 and sugar signaling in systemic acquired resistance of Arabidopsis.
    Plant Physiol. Biochem., 2016. 107: p. 273-287
    [PMID:27337039]
  5. Weiste C, et al.
    The Arabidopsis bZIP11 transcription factor links low-energy signalling to auxin-mediated control of primary root growth.
    PLoS Genet., 2017. 13(2): p. e1006607
    [PMID:28158182]
  6. Yamashita Y, et al.
    Sucrose sensing through nascent peptide-meditated ribosome stalling at the stop codon of Arabidopsis bZIP11 uORF2.
    FEBS Lett., 2017. 591(9): p. 1266-1277
    [PMID:28369795]
  7. Ezer D, et al.
    The G-Box Transcriptional Regulatory Code in Arabidopsis.
    Plant Physiol., 2017. 175(2): p. 628-640
    [PMID:28864470]
  8. Lee DH,Park SJ,Ahn CS,Pai HS
    MRF Family Genes Are Involved in Translation Control, Especially under Energy-Deficient Conditions, and Their Expression and Functions Are Modulated by the TOR Signaling Pathway.
    Plant Cell, 2017. 29(11): p. 2895-2920
    [PMID:29084871]
  9. Pedrotti L, et al.
    Snf1-RELATED KINASE1-Controlled C/S1-bZIP Signaling Activates Alternative Mitochondrial Metabolic Pathways to Ensure Plant Survival in Extended Darkness.
    Plant Cell, 2018. 30(2): p. 495-509
    [PMID:29348240]