PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Cotton_A_07763_BGI-A2_v1.0 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
|
||||||||
Family | BES1 | ||||||||
Protein Properties | Length: 104aa MW: 11617 Da PI: 9.4234 | ||||||||
Description | BES1 family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | DUF822 | 111.8 | 1.1e-34 | 20 | 85 | 12 | 77 |
DUF822 12 rEnnkrRERrRRaiaakiyaGLRaqGnyklpkraDnneVlkALcreAGwvvedDGttyrkgskple 77 rEnn+rRE+ RRa akiy G RaqGny+lpk+ +nneVlkALc+ AGwvvedDGttyr+ +++ Cotton_A_07763_BGI-A2_v1.0 20 RENNRRREKGRRATVAKIYNGPRAQGNYNLPKHYNNNEVLKALCAKAGWVVEDDGTTYRNKVIHEN 85 9**********************************************************7766553 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Pfam | PF05687 | 6.8E-32 | 19 | 81 | IPR008540 | BES1/BZR1 plant transcription factor, N-terminal |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 104 aa Download sequence Send to blast |
MGDIDVDTKI KEEAIVEGGR ENNRRREKGR RATVAKIYNG PRAQGNYNLP KHYNNNEVLK 60 ALCAKAGWVV EDDGTTYRNK VIHENNSSYL KTITVGTEAL LTGP |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
5zd4_A | 8e-19 | 32 | 78 | 391 | 437 | Maltose-binding periplasmic protein,Protein BRASSINAZOLE-RESISTANT 1 |
5zd4_B | 8e-19 | 32 | 78 | 391 | 437 | Maltose-binding periplasmic protein,Protein BRASSINAZOLE-RESISTANT 1 |
5zd4_C | 8e-19 | 32 | 78 | 391 | 437 | Maltose-binding periplasmic protein,Protein BRASSINAZOLE-RESISTANT 1 |
5zd4_D | 8e-19 | 32 | 78 | 391 | 437 | Maltose-binding periplasmic protein,Protein BRASSINAZOLE-RESISTANT 1 |
Search in ModeBase |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | JX589267 | 2e-84 | JX589267.1 Gossypium hirsutum clone NBRI_GE23932 microsatellite sequence. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_006829668.1 | 8e-22 | protein BZR1 homolog 3 | ||||
TrEMBL | A0A444FK93 | 4e-22 | A0A444FK93_ENSVE; Uncharacterized protein | ||||
STRING | ERM97084 | 3e-21 | (Amborella trichopoda) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM15511 | 11 | 17 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G19350.6 | 7e-23 | BES1 family protein |