PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Cotton_A_05832_BGI-A2_v1.0 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
|
||||||||
Family | NAC | ||||||||
Protein Properties | Length: 162aa MW: 18924.3 Da PI: 9.8528 | ||||||||
Description | NAC family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NAM | 174.8 | 2.5e-54 | 8 | 137 | 1 | 129 |
NAM 1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpk..kvka.eekewyfFskrdkkyatgkrknratks 80 +ppGfrFhPtdeel+++yL+kkv+ +k+++ evi+evd++k+ePw+L++ ++ + ++ewyfFs++d+ky+tg+r+nrat++ Cotton_A_05832_BGI-A2_v1.0 8 VPPGFRFHPTDEELLHYYLTKKVSFQKFDM-EVIREVDLNKMEPWELQErcRIGSsPQNEWYFFSHKDRKYPTGSRTNRATNA 89 69****************************.99**************963433332456************************ PP NAM 81 gyWkatgkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrle 129 g+Wkatg+dk + + + +++g++ktLvfy+grap+g+ktdW+mheyrle Cotton_A_05832_BGI-A2_v1.0 90 GFWKATGRDKCIRN-SYKKIGMRKTLVFYRGRAPHGQKTDWIMHEYRLE 137 *************9.8999****************************85 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SuperFamily | SSF101941 | 1.28E-55 | 7 | 145 | IPR003441 | NAC domain |
PROSITE profile | PS51005 | 52.671 | 8 | 155 | IPR003441 | NAC domain |
Pfam | PF02365 | 1.4E-28 | 9 | 136 | IPR003441 | NAC domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0009834 | Biological Process | plant-type secondary cell wall biogenesis | ||||
GO:0045893 | Biological Process | positive regulation of transcription, DNA-templated | ||||
GO:0048829 | Biological Process | root cap development | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 162 aa Download sequence Send to blast |
MGSTNGGVPP GFRFHPTDEE LLHYYLTKKV SFQKFDMEVI REVDLNKMEP WELQERCRIG 60 SSPQNEWYFF SHKDRKYPTG SRTNRATNAG FWKATGRDKC IRNSYKKIGM RKTLVFYRGR 120 APHGQKTDWI MHEYRLEDGD DPQGNPTVST RSLYSHATLG PN |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
3ulx_A | 3e-49 | 8 | 136 | 15 | 140 | Stress-induced transcription factor NAC1 |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription activator. Together with BRN1 and SMB, regulates cellular maturation of root cap. Promotes the expression of genes involved in secondary cell walls (SCW) biosynthesis. {ECO:0000269|PubMed:20197506}. |
Binding Motif ? help Back to Top | |||
---|---|---|---|
Motif ID | Method | Source | Motif file |
MP00431 | DAP | Transfer from AT4G10350 | Download |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | JX623241 | 4e-81 | JX623241.1 Gossypium hirsutum clone NBRI_GE70350 microsatellite sequence. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_012478041.1 | 1e-108 | PREDICTED: protein BEARSKIN2 | ||||
Swissprot | Q9SV87 | 1e-100 | BRN2_ARATH; Protein BEARSKIN2 | ||||
TrEMBL | A0A0D2R4S8 | 1e-106 | A0A0D2R4S8_GOSRA; Uncharacterized protein | ||||
STRING | Gorai.004G267300.1 | 1e-107 | (Gossypium raimondii) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM5213 | 26 | 48 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT4G10350.1 | 1e-102 | NAC domain containing protein 70 |
Publications ? help Back to Top | |||
---|---|---|---|
|