PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID mrna30834.1-v1.0-hybrid
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Rosoideae; Potentilleae; Fragariinae; Fragaria
Family TALE
Protein Properties Length: 324aa    MW: 36600.1 Da    PI: 5.4584
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
mrna30834.1-v1.0-hybridgenomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox23.97.3e-082612942154
                              HSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
                 Homeobox  21 knrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                              k +yp++e++++L +++gL+ +q+ +WF N+R +
  mrna30834.1-v1.0-hybrid 261 KWPYPTEEDKARLVQETGLQLKQINNWFINQRKR 294
                              469*****************************87 PP

2ELK29.32e-10215236122
                      ELK   1 ELKhqLlrKYsgyLgsLkqEFs 22 
                              ELKh+L+++Y+++++++++E++
  mrna30834.1-v1.0-hybrid 215 ELKHELKQGYKEKIVDIREEIL 236
                              9*******************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM012558.5E-174892IPR005540KNOX1
PfamPF037901.4E-165090IPR005540KNOX1
SMARTSM012564.9E-23104159IPR005541KNOX2
PfamPF037911.8E-17110158IPR005541KNOX2
PfamPF037897.1E-7215236IPR005539ELK domain
PROSITE profilePS512139.969215235IPR005539ELK domain
SMARTSM011886.1E-4215236IPR005539ELK domain
PROSITE profilePS5007111.726235298IPR001356Homeobox domain
SMARTSM003895.0E-11237302IPR001356Homeobox domain
SuperFamilySSF466893.94E-16237300IPR009057Homeodomain-like
CDDcd000868.45E-12238299No hitNo description
Gene3DG3DSA:1.10.10.602.9E-25242300IPR009057Homeodomain-like
PfamPF059201.3E-17255294IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009416Biological Processresponse to light stimulus
GO:0009722Biological Processdetection of cytokinin stimulus
GO:0071345Biological Processcellular response to cytokine stimulus
GO:0005634Cellular Componentnucleus
GO:0005829Cellular Componentcytosol
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 324 aa     Download sequence    Send to blast
MAFHGSFPDT QQPPQLAPTW LNAPPFRSSP SGKSGEEDGE DEMEGESGRF KADIVGHPLY  60
EQLVSAHVSC LRIATPVDQL PKIDEQLVQS QRVVDKYSAM RANGEFGVLD EKELDMFMTN  120
YVLLLCSFKE QLQQHVRVHA MEAVMACWEL EQSLQSLTGV STAEGTGATM SDDDEQFDGD  180
ISSYDASLDG HDTMGFGPLM PTESERSLME RVRQELKHEL KQGYKEKIVD IREEILRKRR  240
AGKLPGDTTS VLKAWWQTHS KWPYPTEEDK ARLVQETGLQ LKQINNWFIN QRKRNWHSNL  300
STTSVLKSKR KSNAGDGNSQ RLK*
Cis-element ? help Back to Top
SourceLink
PlantRegMapmrna30834.1-v1.0-hybrid
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011469909.10.0PREDICTED: homeobox protein knotted-1-like 3 isoform X1
SwissprotP480001e-160KNAT3_ARATH; Homeobox protein knotted-1-like 3
TrEMBLA0A2P6RIH80.0A0A2P6RIH8_ROSCH; Putative transcription factor Homobox-WOX family
STRINGXP_004287231.10.0(Fragaria vesca)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF101734108
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G25220.11e-162KNOTTED1-like homeobox gene 3
Publications ? help Back to Top
  1. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]