PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID mrna29752.1-v1.0-hybrid
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Rosoideae; Potentilleae; Fragariinae; Fragaria
Family HB-other
Protein Properties Length: 1784aa    MW: 199683 Da    PI: 4.9675
Description HB-other family protein
Gene Model
Gene Model ID Type Source Coding Sequence
mrna29752.1-v1.0-hybridgenomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox57.81.8e-183186257
                             T--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHHC CS
                 Homeobox  2 rkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakekk 57
                              kR+  t+ qle+Le++++ + yps++ r+eL++klgL++rq ++WF+ rR k+kk
  mrna29752.1-v1.0-hybrid 31 PKRQMKTPFQLEALEKAYAVETYPSESIRAELSEKLGLSDRQLQMWFCHRRLKDKK 86
                             69****************************************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.609.2E-19987IPR009057Homeodomain-like
SuperFamilySSF466891.88E-161687IPR009057Homeodomain-like
PROSITE profilePS5007116.3422787IPR001356Homeobox domain
SMARTSM003895.1E-182991IPR001356Homeobox domain
PfamPF000464.1E-163186IPR001356Homeobox domain
CDDcd000862.26E-143287No hitNo description
SMARTSM005711.7E-20563622IPR018501DDT domain
PROSITE profilePS5082716.873563622IPR018501DDT domain
PfamPF027912.7E-17564619IPR018501DDT domain
PfamPF050664.7E-16745813IPR007759HB1/Asxl, restriction endonuclease HTH domain
PfamPF156122.3E-59631007IPR028942WHIM1 domain
PfamPF156131.5E-1211431234IPR028941WHIM2 domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010228Biological Processvegetative to reproductive phase transition of meristem
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 1784 aa     Download sequence    Send to blast
MEGSEGDNQN RNHENSNSKL NNSGDGGGGK PKRQMKTPFQ LEALEKAYAV ETYPSESIRA  60
ELSEKLGLSD RQLQMWFCHR RLKDKKEGGS GSGPGPGPGP GPGPAKKQRK AVAVLPEPPI  120
DDLAHGSEPG SDYGSGSGSG SSPFGHADRN VVSRNVVVVE DVPRTRHYGS QQSITELRAI  180
AIVEAQLGEP LREDGPVLGI EFDPLPPDAF GAPLGILLSS QCFISANPFV LLLYESVAEQ  240
QKRNESKPNK GTPRSLHEYP YLQDHSSVRP DVYGHVAQSH FRDSAIDGPN ARTSPFASGN  300
EQLPRVHGGH GRARLLSQQE RQAVTFASPG DDGLPQRDAF INGRMSTQYS EPPFIAPESS  360
NVLSDGQIND TMLRMERKRK GEDVRMAKEV EAHEVRIRKE MEKQDILRRK NEERIRREME  420
RQDRERRKEE ERLMRERQRE EERSKKEQKR ENERREKFLQ KENIRAEKRR QREELRKERE  480
EVRRKAALEK ATARRLLNKS MELYEDEQLE LMELAAASKG LSSIISIDPD TNLDAFRDDL  540
TAFPPKSVLL KRPFAVHPWI DSEENIGNFL MVWRFLITFA DILELWPFTL DEFVQAFHDY  600
DSRLLGEIHV ALLRLIIKDI EDVARTPSTG LGLNQNGAAN PGGGHPQIVE GAYAWGFDIR  660
NWQQHLNLLT WPEIFRQLAL SAGFGPQLKK RSISWSYLPD NDEGKGCHDV ISTLRNGSAA  720
ENAFAIMQEK GLLAPRRSRH RLTPGTVKFA AFHVLSLEGN KGLTVLELAE KIQKSGLRDL  780
TTSKTPEASI SVALTRDTKL FERIAPSTYR VRSAYRKDPT DAEAILTAAR KKVQIFETGI  840
LAAEDVDEVE RDDVEEVERD EDSECDDVDE DPEVDDLATP AIVKKSPDQY NEVTPFSENG  900
QEDVCNDVAQ NVQNEMDKDV SPIPVSASKE ADGPSASSKQ CVSGVEVSTS NLDQDNMEID  960
ESKAGESWVQ GLTEGDYSDL SVEERLNSLV SLIGIANEGN SIRVVLEDRL EAANALKKQM  1020
WADAQLDKSR LKEENVSRLD IPSFMVGKAE HVTGVEDGQS PLLDIDSRIN EEGAAENQSS  1080
NHGSQVILNH LHGVPIERAL VPQDISMGPE NILNQQLAYA SKKSRSQLKS YIAHKAEEMY  1140
AYRSLPLGQD RRHNRYWQFV ASASSSDPGS GRIFIELNNG NWRLIDTEEM GLRDWCVLLP  1200
GKFTVTAEAF DTLLMSLDTR GIRESHLRLM LQKIEASFKE NVRKNVHLSS RNRVKKEADD  1260
MDSSPDYPSS FDSPGSTVSA LNSEMGETSS SFRIELNRNE NEKRAALRRY QDFQKWMWRE  1320
CFSTSALCAS KYGQKRCRQL FDLCDFCLCC YHFEDSHCSF CHQTFGATYE NLDFSEHVIQ  1380
CKERRNLETC DIHVPGISVP LASRLLKAFI TLVEVSVPPE ALQSFWTEDC RKTWGAKLNA  1440
SSSVEELLQM LTLFETAIKR DFVSSNFAAT DELLGSGKQS AIANSDNLDT KSISVLPWIP  1500
HTTAAVALRV YEMDSAITYV PHEKPEPNGD KEVGEHIKIP LRFTPMRNDR EFEPAASDLN  1560
EQSTHLKSAR NSLKRGRGGR EQGRGKKSKS GGSRRKARGN EIENMRQGLG PVGRRPQGQG  1620
SGRGRRTVRK RRMKNSAVEG TLIGHTTDLR SSPDSGEESP RNLAGEWDDE NINMIHMKGD  1680
ERGERYEQAE ALESEDEDQA VGYEQGNWEI GFDGISGGWN GGLQEPSDED MGASEDDNNG  1740
IEEVREEDSE GDVEMSDASD EVPNRIINDD GSDSASDDDD YSD*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
17986RRLKDKKE
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional regulator required for the maintenance of the plant vegetative phase. In association with CHR11 or CHR17 may prevent the early activation of the vegetative-to-reproductive transition by regulating key genes that contribute to flower timing, such as FT, SEP1, SEP3, AGL8/FUL, SOC1 and FLC. {ECO:0000269|PubMed:22694359}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapmrna29752.1-v1.0-hybrid
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEU6034051e-170EU603405.1 Rosa hybrid cultivar putative homeobox transcription factor mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004293789.10.0PREDICTED: uncharacterized protein LOC101298204 isoform X1
SwissprotF4HY560.0RLT1_ARATH; Homeobox-DDT domain protein RLT1
TrEMBLA0A2P6Q4980.0A0A2P6Q498_ROSCH; Putative transcription factor & chromatin remodeling DDT family
STRINGXP_004293789.10.0(Fragaria vesca)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF25233369
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G28420.10.0homeobox-1