PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | mrna29726.1-v1.0-hybrid | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Rosoideae; Potentilleae; Fragariinae; Fragaria
|
||||||||
Family | SBP | ||||||||
Protein Properties | Length: 158aa MW: 17887.7 Da PI: 7.8446 | ||||||||
Description | SBP family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | SBP | 135.7 | 1.5e-42 | 77 | 153 | 2 | 78 |
-SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S--- CS SBP 2 CqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkqa 78 Cq+++C+adls+ak+y+rrhkvC++hskapvv++ gl+qrfCqqCsrfh+lsefDe+krsCrrrLa+hnerrrk+++ mrna29726.1-v1.0-hybrid 77 CQAQSCNADLSDAKQYYRRHKVCDFHSKAPVVVIGGLRQRFCQQCSRFHDLSEFDENKRSCRRRLAGHNERRRKNSS 153 **************************************************************************975 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PIRSF | PIRSF037575 | 4.9E-57 | 1 | 157 | IPR017238 | Squamosa promoter-binding protein |
Gene3D | G3DSA:4.10.1100.10 | 3.1E-35 | 70 | 138 | IPR004333 | Transcription factor, SBP-box |
PROSITE profile | PS51141 | 32.12 | 74 | 151 | IPR004333 | Transcription factor, SBP-box |
SuperFamily | SSF103612 | 3.53E-39 | 75 | 154 | IPR004333 | Transcription factor, SBP-box |
Pfam | PF03110 | 1.3E-32 | 77 | 150 | IPR004333 | Transcription factor, SBP-box |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0009911 | Biological Process | positive regulation of flower development | ||||
GO:0010228 | Biological Process | vegetative to reproductive phase transition of meristem | ||||
GO:0010229 | Biological Process | inflorescence development | ||||
GO:0010321 | Biological Process | regulation of vegetative phase change | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 158 aa Download sequence Send to blast |
MEPNKAQGKR SLNLDIEEEE EEEEADEDED HTSRPSVLVH GEDDRRKRVM VMNSASATSP 60 SKKGSAAGGS MTTRPSCQAQ SCNADLSDAK QYYRRHKVCD FHSKAPVVVI GGLRQRFCQQ 120 CSRFHDLSEF DENKRSCRRR LAGHNERRRK NSSDYPN* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1ul4_A | 3e-34 | 77 | 150 | 11 | 84 | squamosa promoter binding protein-like 4 |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Probable transcriptional factor. Binds to the promoter of the SQUAMOSA gene. |
Binding Motif ? help Back to Top | |||
---|---|---|---|
Motif ID | Method | Source | Motif file |
MP00290 | DAP | Transfer from AT2G33810 | Download |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | mrna29726.1-v1.0-hybrid |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_004293885.1 | 1e-114 | PREDICTED: squamosa promoter-binding-like protein 3 | ||||
Swissprot | Q38741 | 6e-45 | SBP1_ANTMA; Squamosa promoter-binding protein 1 | ||||
TrEMBL | A0A2P6Q483 | 1e-83 | A0A2P6Q483_ROSCH; Squamosa promoter-binding-like protein | ||||
STRING | XP_004293885.1 | 1e-113 | (Fragaria vesca) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF535 | 34 | 153 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT2G33810.1 | 1e-41 | squamosa promoter binding protein-like 3 |
Link Out ? help Back to Top | |
---|---|
Phytozome | mrna29726.1-v1.0-hybrid |
Publications ? help Back to Top | |||
---|---|---|---|
|