PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | mrna29662.1-v1.0-hybrid | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Rosoideae; Potentilleae; Fragariinae; Fragaria
|
||||||||
Family | Dof | ||||||||
Protein Properties | Length: 171aa MW: 19189 Da PI: 9.151 | ||||||||
Description | Dof family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | zf-Dof | 122.6 | 1.4e-38 | 51 | 109 | 2 | 60 |
zf-Dof 2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkk 60 +ek+++cprC+s++tkfCy+nny+++qPr+fCk+C+ryWt+GGalrnvPvG+grrk+k mrna29662.1-v1.0-hybrid 51 PEKIIPCPRCKSMETKFCYFNNYNVNQPRHFCKGCQRYWTAGGALRNVPVGAGRRKSKP 109 68999***************************************************985 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
ProDom | PD007478 | 1.0E-29 | 50 | 108 | IPR003851 | Zinc finger, Dof-type |
Pfam | PF02701 | 5.3E-32 | 53 | 108 | IPR003851 | Zinc finger, Dof-type |
PROSITE profile | PS50884 | 28.425 | 55 | 109 | IPR003851 | Zinc finger, Dof-type |
PROSITE pattern | PS01361 | 0 | 57 | 93 | IPR003851 | Zinc finger, Dof-type |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0010214 | Biological Process | seed coat development | ||||
GO:0045892 | Biological Process | negative regulation of transcription, DNA-templated | ||||
GO:1902455 | Biological Process | negative regulation of stem cell population maintenance | ||||
GO:0044212 | Molecular Function | transcription regulatory region DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 171 aa Download sequence Send to blast |
MAEVSSGQGA PGIKLFGTTI TLQQVVVKDD HHREQKKADD VHDQTVEMKR PEKIIPCPRC 60 KSMETKFCYF NNYNVNQPRH FCKGCQRYWT AGGALRNVPV GAGRRKSKPP CRELVGFPEP 120 CMYEASEVVH QFELEGVVEK WHVAAVQGDF RHVFPVVKRR RSGSGGQTCS * |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor that binds specifically to a 5'-AA[AG]G-3' consensus core sequence (By similarity). Transcriptional repressor of 'CONSTANS' expression (By similarity). Regulates a photoperiodic flowering response. {ECO:0000250, ECO:0000269|PubMed:19619493}. |
Binding Motif ? help Back to Top | |||
---|---|---|---|
Motif ID | Method | Source | Motif file |
MP00166 | DAP | Transfer from AT1G29160 | Download |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | mrna29662.1-v1.0-hybrid |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Circadian-regulation. The transcript level rises progressively from dawn and decreases during the night. {ECO:0000269|PubMed:19619493}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | Retrieve |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AP006693 | 1e-40 | AP006693.1 Lotus japonicus genomic DNA, chromosome 4, clone: LjT35C17, TM0399, complete sequence. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_004293942.1 | 1e-126 | PREDICTED: dof zinc finger protein DOF1.5 | ||||
Swissprot | O22967 | 6e-56 | CDF4_ARATH; Cyclic dof factor 4 | ||||
TrEMBL | A0A2P6Q4P0 | 1e-108 | A0A2P6Q4P0_ROSCH; Putative transcription factor C2C2-Dof family | ||||
STRING | XP_004293942.1 | 1e-125 | (Fragaria vesca) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF6483 | 32 | 51 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT2G34140.1 | 3e-58 | Dof family protein |
Link Out ? help Back to Top | |
---|---|
Phytozome | mrna29662.1-v1.0-hybrid |
Publications ? help Back to Top | |||
---|---|---|---|
|