PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID mrna29103.1-v1.0-hybrid
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Rosoideae; Potentilleae; Fragariinae; Fragaria
Family ZF-HD
Protein Properties Length: 384aa    MW: 42101.7 Da    PI: 7.3861
Description ZF-HD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
mrna29103.1-v1.0-hybridgenomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1ZF-HD_dimer100.11.6e-31133188359
              ZF-HD_dimer   3 kvrYkeClkNhAaslGghavDGCgEfmpsegeegtaaalkCaACgCHRnFHRrevee 59 
                              +++YkeClkNhAa++Gg+a+DGCgEfmps geegt++al+C+AC+CHRnFHR+e e 
  mrna29103.1-v1.0-hybrid 133 SIKYKECLKNHAAAMGGTATDGCGEFMPS-GEEGTIEALNCSACNCHRNFHRKEIEG 188
                              689*************************9.999********************9875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD1257745.0E-25134189IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PfamPF047701.0E-28134186IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
TIGRFAMsTIGR015662.2E-31135186IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PROSITE profilePS5152327.067136185IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
SuperFamilySSF466896.28E-18309371IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.602.2E-28309371IPR009057Homeodomain-like
TIGRFAMsTIGR015658.9E-27310366IPR006455Homeodomain, ZF-HD class
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0048574Biological Processlong-day photoperiodism, flowering
GO:0003677Molecular FunctionDNA binding
GO:0042803Molecular Functionprotein homodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 384 aa     Download sequence    Send to blast
MELSSHQEGQ IPISIPIPIP IPINTSYGAG GHGHGHMIHH HHHHEPAASH SHTLIHNSHL  60
ITSSAPPVVA PPPPQNQIPA SINNNGSSIP TATSPDQEEQ EEEDEEHVNH VNVAYNHNHN  120
NNSNNNKKVV NSSIKYKECL KNHAAAMGGT ATDGCGEFMP SGEEGTIEAL NCSACNCHRN  180
FHRKEIEGDH GMSSWDVNNN STRVGTVGRK VLLGHPNAHN NMSILAADAL GFHTAANPTG  240
GFLPSRTAPH HPHHHPHQMI MSYNNNMSMG GLMGTHLPSE SDEQEQDQIH HHGHGGGVNV  300
ASRAPVQLVK KRFRTKFTQE QKEKMFNFAE KVGWKIQKQE ESVVQNFCHE IGVKRRVLKV  360
WMHNNKHNLA KNKSQPPPST TTA*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wh7_A6e-223113681875ZF-HD homeobox family protein
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtPutative transcription factor. Probably involved in the regulation of floral induction. {ECO:0000269|PubMed:22319055}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapmrna29103.1-v1.0-hybrid
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Induced by exposure to long days. {ECO:0000269|PubMed:22319055}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankFJ4929603e-56FJ492960.1 Rhamnus alaternus microsatellite RaA117 sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004301574.10.0PREDICTED: zinc-finger homeodomain protein 4-like
SwissprotQ9M9S01e-64ZHD4_ARATH; Zinc-finger homeodomain protein 4
TrEMBLA0A2P6PCH90.0A0A2P6PCH9_ROSCH; Putative transcription factor ZF-HD family
STRINGXP_004301574.10.0(Fragaria vesca)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF20634253
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G14440.29e-64homeobox protein 31