PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | mrna28941.1-v1.0-hybrid | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Rosoideae; Potentilleae; Fragariinae; Fragaria
|
||||||||
Family | NF-YA | ||||||||
Protein Properties | Length: 172aa MW: 18961.1 Da PI: 9.4698 | ||||||||
Description | NF-YA family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | CBFB_NFYA | 102.9 | 3e-32 | 79 | 135 | 1 | 58 |
CBFB_NFYA 1 deplYVNaKQyqrIlkRRqkRakleeekkldeksrkpylheSRhkhAlrRpRgsgGrF 58 +ep++VNaKQy++Il+RRq+Rak+e+e+k k+rkpylheSRh hAlrR+Rg+gGrF mrna28941.1-v1.0-hybrid 79 EEPVFVNAKQYHGILRRRQSRAKAESENKA-LKNRKPYLHESRHLHALRRARGCGGRF 135 69***************************9.9*************************9 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SMART | SM00521 | 9.0E-36 | 77 | 138 | IPR001289 | Nuclear transcription factor Y subunit A |
PROSITE profile | PS51152 | 36.942 | 78 | 138 | IPR001289 | Nuclear transcription factor Y subunit A |
Pfam | PF02045 | 2.7E-27 | 80 | 135 | IPR001289 | Nuclear transcription factor Y subunit A |
PRINTS | PR00616 | 1.6E-23 | 81 | 103 | IPR001289 | Nuclear transcription factor Y subunit A |
PROSITE pattern | PS00686 | 0 | 83 | 103 | IPR018362 | CCAAT-binding factor, conserved site |
PRINTS | PR00616 | 1.6E-23 | 112 | 135 | IPR001289 | Nuclear transcription factor Y subunit A |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0045892 | Biological Process | negative regulation of transcription, DNA-templated | ||||
GO:0016602 | Cellular Component | CCAAT-binding factor complex | ||||
GO:0003677 | Molecular Function | DNA binding | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 172 aa Download sequence Send to blast |
MSHPGIPGPM QYVTPPQIGA GHAVAPGAYP YPDPYYRSIF APYDTQAYPP QPYGGQPTVH 60 LQLMGIQQAG VPLPTDAVEE PVFVNAKQYH GILRRRQSRA KAESENKALK NRKPYLHESR 120 HLHALRRARG CGGRFLNAKK DENEQSGGEN SQTIINLNSD ENERSSSDRT S* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
4awl_A | 1e-20 | 78 | 143 | 1 | 66 | NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT ALPHA |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. {ECO:0000250}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | mrna28941.1-v1.0-hybrid |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_004293988.1 | 1e-125 | PREDICTED: nuclear transcription factor Y subunit A-7 | ||||
Refseq | XP_011460650.1 | 1e-125 | PREDICTED: nuclear transcription factor Y subunit A-7 | ||||
Swissprot | Q84JP1 | 2e-65 | NFYA7_ARATH; Nuclear transcription factor Y subunit A-7 | ||||
TrEMBL | A0A2P6Q631 | 1e-115 | A0A2P6Q631_ROSCH; Putative transcription factor Hap2/NF-YA family | ||||
STRING | XP_004293988.1 | 1e-124 | (Fragaria vesca) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF5379 | 33 | 55 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G30500.2 | 4e-52 | nuclear factor Y, subunit A7 |
Link Out ? help Back to Top | |
---|---|
Phytozome | mrna28941.1-v1.0-hybrid |
Publications ? help Back to Top | |||
---|---|---|---|
|