PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID mrna27383.1-v1.0-hybrid
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Rosoideae; Potentilleae; Fragariinae; Fragaria
Family CO-like
Protein Properties Length: 357aa    MW: 38994 Da    PI: 5.7231
Description CO-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
mrna27383.1-v1.0-hybridgenomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-B_box231.7e-071555438
                 zf-B_box  4 rkCpeHeekelqlfCedCqqllCedClleeHkg......Ht 38
                             + C+++++ ++  fC+ ++ +lC  C +++H        H+
  mrna27383.1-v1.0-hybrid 15 KPCDTCKSSPAAVFCRADSAYLCLACDSKIHCAnklasrHQ 55
                             68****************************95545666666 PP

2zf-B_box24.36.5e-085699239
                 zf-B_box  2 eerkCpeHeekelqlfCedCqqllCedClleeHkg......Htv 39
                             + ++C+ +e+ ++   C+ +   lC +C   +H+       H++
  mrna27383.1-v1.0-hybrid 56 RVWMCEVCEQAPAAVTCKADAAALCVTCDADIHSAnplarrHER 99
                             5789*****************************65777777775 PP

3CCT70.44.6e-24283327145
                      CCT   1 ReaallRYkeKrktRkFeKkirYesRKavAesRpRvKGrFvkqae 45 
                              Rea+++RY+eKrk+R F+K+irY+sRKa+Ae+RpR+KGrF+k++e
  mrna27383.1-v1.0-hybrid 283 REARVMRYREKRKNRTFQKTIRYASRKAYAETRPRIKGRFAKRSE 327
                              9*****************************************975 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003365.2E-121259IPR000315B-box-type zinc finger
PROSITE profilePS5011910.3381259IPR000315B-box-type zinc finger
PfamPF006433.4E-51555IPR000315B-box-type zinc finger
CDDcd000215.76E-91659No hitNo description
PROSITE profilePS5011910.60855102IPR000315B-box-type zinc finger
PfamPF006435.2E-656101IPR000315B-box-type zinc finger
CDDcd000211.09E-858102No hitNo description
SMARTSM003364.9E-1060102IPR000315B-box-type zinc finger
PROSITE profilePS5101716.638283325IPR010402CCT domain
PfamPF062032.1E-18283325IPR010402CCT domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005622Cellular Componentintracellular
GO:0005515Molecular Functionprotein binding
GO:0008270Molecular Functionzinc ion binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0009005anatomyroot
PO:0007134developmental stagesporophyte vegetative stage
Sequence ? help Back to Top
Protein Sequence    Length: 357 aa     Download sequence    Send to blast
MGIQSCWTLP GLSPKPCDTC KSSPAAVFCR ADSAYLCLAC DSKIHCANKL ASRHQRVWMC  60
EVCEQAPAAV TCKADAAALC VTCDADIHSA NPLARRHERF PVEPFLDSAE SIAKSTSSAF  120
NDAVSTIKND DADSLLIPNL NFTSKFVDAL DMKPDMYFPE MESLLEFDYP NPIQNSSLGM  180
DSVVPVQPDP IPPAPVLHQP SQESCFDIDF CRSKLSSSFS YPAQSISQSV SSSSLDVGVV  240
PDGNSFSDIS YPFIANVNQN GMDSGVPAPA TVSQATQLTG VDREARVMRY REKRKNRTFQ  300
KTIRYASRKA YAETRPRIKG RFAKRSESET EVMDRIFNSA PGSYIADAQY GVVPTF*
Cis-element ? help Back to Top
SourceLink
PlantRegMapmrna27383.1-v1.0-hybrid
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB9265037e-66AB926503.1 Rubus grayanus gene for zinc finger protein CONSTANS-LIKE homolog, partial cds, isolate: gYK-233_09.
GenBankAB9265087e-66AB926508.1 Rubus grayanus gene for zinc finger protein CONSTANS-LIKE homolog, partial cds, isolate: gYK-245_09.
GenBankAB9265097e-66AB926509.1 Rubus grayanus gene for zinc finger protein CONSTANS-LIKE homolog, partial cds, isolate: gYK-253_09.
GenBankAB9265107e-66AB926510.1 Rubus grayanus gene for zinc finger protein CONSTANS-LIKE homolog, partial cds, isolate: gYK-317_09.
GenBankAB9265147e-66AB926514.1 Rubus grayanus gene for zinc finger protein CONSTANS-LIKE homolog, partial cds, isolate: gYK-321_09.
GenBankAB9265157e-66AB926515.1 Rubus grayanus gene for zinc finger protein CONSTANS-LIKE homolog, partial cds, isolate: gYK-323_09.
GenBankAB9265167e-66AB926516.1 Rubus grayanus gene for zinc finger protein CONSTANS-LIKE homolog, partial cds, isolate: gYK-328_09.
GenBankAB9265177e-66AB926517.1 Rubus grayanus gene for zinc finger protein CONSTANS-LIKE homolog, partial cds, isolate: gYK-329_09.
GenBankAB9265417e-66AB926541.1 Rubus grayanus gene for zinc finger protein CONSTANS-LIKE homolog, partial cds, isolate: gTN-01_09.
GenBankAB9311757e-66AB931175.1 Rubus grayanus gene for zinc finger protein CONSTANS-LIKE homolog, partial cds, isolate: ab1-45_09.
GenBankAB9311787e-66AB931178.1 Rubus grayanus gene for zinc finger protein CONSTANS-LIKE homolog, partial cds, isolate: ab1-54_09.
GenBankAB9311797e-66AB931179.1 Rubus grayanus gene for zinc finger protein CONSTANS-LIKE homolog, partial cds, isolate: ab1-55_09.
GenBankAB9311807e-66AB931180.1 Rubus grayanus gene for zinc finger protein CONSTANS-LIKE homolog, partial cds, isolate: ab1-56_09.
GenBankAB9311817e-66AB931181.1 Rubus grayanus gene for zinc finger protein CONSTANS-LIKE homolog, partial cds, isolate: ab1-57_09.
GenBankAB9311837e-66AB931183.1 Rubus sp. MM-2014 gene for zinc finger protein CONSTANS-LIKE homolog, partial cds, isolate: ab2-70_09.
GenBankAB9311847e-66AB931184.1 Rubus sp. MM-2014 gene for zinc finger protein CONSTANS-LIKE homolog, partial cds, isolate: ab2-72_09.
GenBankAB9312327e-66AB931232.1 Rubus sp. MM-2014 gene for zinc finger protein CONSTANS-LIKE homolog, partial cds, isolate: sr2-310_09.
GenBankAB9312337e-66AB931233.1 Rubus sp. MM-2014 gene for zinc finger protein CONSTANS-LIKE homolog, partial cds, isolate: sr2-311_09.
GenBankAB9312357e-66AB931235.1 Rubus sp. MM-2014 gene for zinc finger protein CONSTANS-LIKE homolog, partial cds, isolate: sr2-314_09.
GenBankAB9312417e-66AB931241.1 Rubus sp. MM-2014 gene for zinc finger protein CONSTANS-LIKE homolog, partial cds, isolate: sr3-296_09.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011462636.10.0PREDICTED: zinc finger protein CONSTANS-LIKE 5
SwissprotQ9FHH81e-107COL5_ARATH; Zinc finger protein CONSTANS-LIKE 5
TrEMBLA0A2P6QTN40.0A0A2P6QTN4_ROSCH; Putative transcription factor C2C2-CO-like family
STRINGEMJ242981e-143(Prunus persica)
STRINGXP_004507812.11e-143(Cicer arietinum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF13023493
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G57660.12e-99CONSTANS-like 5
Publications ? help Back to Top
  1. Vercruyssen L, et al.
    ANGUSTIFOLIA3 binds to SWI/SNF chromatin remodeling complexes to regulate transcription during Arabidopsis leaf development.
    Plant Cell, 2014. 26(1): p. 210-29
    [PMID:24443518]