Signature Domain? help Back to Top |
|
No. |
Domain |
Score |
E-value |
Start |
End |
HMM Start |
HMM End |
1 | zf-B_box | 23 | 1.7e-07 | 15 | 55 | 4 | 38 |
zf-B_box 4 rkCpeHeekelqlfCedCqqllCedClleeHkg......Ht 38
+ C+++++ ++ fC+ ++ +lC C +++H H+
mrna27383.1-v1.0-hybrid 15 KPCDTCKSSPAAVFCRADSAYLCLACDSKIHCAnklasrHQ 55
68****************************95545666666 PP
|
2 | zf-B_box | 24.3 | 6.5e-08 | 56 | 99 | 2 | 39 |
zf-B_box 2 eerkCpeHeekelqlfCedCqqllCedClleeHkg......Htv 39
+ ++C+ +e+ ++ C+ + lC +C +H+ H++
mrna27383.1-v1.0-hybrid 56 RVWMCEVCEQAPAAVTCKADAAALCVTCDADIHSAnplarrHER 99
5789*****************************65777777775 PP
|
3 | CCT | 70.4 | 4.6e-24 | 283 | 327 | 1 | 45 |
CCT 1 ReaallRYkeKrktRkFeKkirYesRKavAesRpRvKGrFvkqae 45
Rea+++RY+eKrk+R F+K+irY+sRKa+Ae+RpR+KGrF+k++e
mrna27383.1-v1.0-hybrid 283 REARVMRYREKRKNRTFQKTIRYASRKAYAETRPRIKGRFAKRSE 327
9*****************************************975 PP
|
Annotation --
Nucleotide ? help
Back to Top |
Source |
Hit ID |
E-value |
Description |
GenBank | AB926503 | 7e-66 | AB926503.1 Rubus grayanus gene for zinc finger protein CONSTANS-LIKE homolog, partial cds, isolate: gYK-233_09. |
GenBank | AB926508 | 7e-66 | AB926508.1 Rubus grayanus gene for zinc finger protein CONSTANS-LIKE homolog, partial cds, isolate: gYK-245_09. |
GenBank | AB926509 | 7e-66 | AB926509.1 Rubus grayanus gene for zinc finger protein CONSTANS-LIKE homolog, partial cds, isolate: gYK-253_09. |
GenBank | AB926510 | 7e-66 | AB926510.1 Rubus grayanus gene for zinc finger protein CONSTANS-LIKE homolog, partial cds, isolate: gYK-317_09. |
GenBank | AB926514 | 7e-66 | AB926514.1 Rubus grayanus gene for zinc finger protein CONSTANS-LIKE homolog, partial cds, isolate: gYK-321_09. |
GenBank | AB926515 | 7e-66 | AB926515.1 Rubus grayanus gene for zinc finger protein CONSTANS-LIKE homolog, partial cds, isolate: gYK-323_09. |
GenBank | AB926516 | 7e-66 | AB926516.1 Rubus grayanus gene for zinc finger protein CONSTANS-LIKE homolog, partial cds, isolate: gYK-328_09. |
GenBank | AB926517 | 7e-66 | AB926517.1 Rubus grayanus gene for zinc finger protein CONSTANS-LIKE homolog, partial cds, isolate: gYK-329_09. |
GenBank | AB926541 | 7e-66 | AB926541.1 Rubus grayanus gene for zinc finger protein CONSTANS-LIKE homolog, partial cds, isolate: gTN-01_09. |
GenBank | AB931175 | 7e-66 | AB931175.1 Rubus grayanus gene for zinc finger protein CONSTANS-LIKE homolog, partial cds, isolate: ab1-45_09. |
GenBank | AB931178 | 7e-66 | AB931178.1 Rubus grayanus gene for zinc finger protein CONSTANS-LIKE homolog, partial cds, isolate: ab1-54_09. |
GenBank | AB931179 | 7e-66 | AB931179.1 Rubus grayanus gene for zinc finger protein CONSTANS-LIKE homolog, partial cds, isolate: ab1-55_09. |
GenBank | AB931180 | 7e-66 | AB931180.1 Rubus grayanus gene for zinc finger protein CONSTANS-LIKE homolog, partial cds, isolate: ab1-56_09. |
GenBank | AB931181 | 7e-66 | AB931181.1 Rubus grayanus gene for zinc finger protein CONSTANS-LIKE homolog, partial cds, isolate: ab1-57_09. |
GenBank | AB931183 | 7e-66 | AB931183.1 Rubus sp. MM-2014 gene for zinc finger protein CONSTANS-LIKE homolog, partial cds, isolate: ab2-70_09. |
GenBank | AB931184 | 7e-66 | AB931184.1 Rubus sp. MM-2014 gene for zinc finger protein CONSTANS-LIKE homolog, partial cds, isolate: ab2-72_09. |
GenBank | AB931232 | 7e-66 | AB931232.1 Rubus sp. MM-2014 gene for zinc finger protein CONSTANS-LIKE homolog, partial cds, isolate: sr2-310_09. |
GenBank | AB931233 | 7e-66 | AB931233.1 Rubus sp. MM-2014 gene for zinc finger protein CONSTANS-LIKE homolog, partial cds, isolate: sr2-311_09. |
GenBank | AB931235 | 7e-66 | AB931235.1 Rubus sp. MM-2014 gene for zinc finger protein CONSTANS-LIKE homolog, partial cds, isolate: sr2-314_09. |
GenBank | AB931241 | 7e-66 | AB931241.1 Rubus sp. MM-2014 gene for zinc finger protein CONSTANS-LIKE homolog, partial cds, isolate: sr3-296_09. |