PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID mrna27169.1-v1.0-hybrid
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Rosoideae; Potentilleae; Fragariinae; Fragaria
Family NZZ/SPL
Protein Properties Length: 445aa    MW: 48212.7 Da    PI: 7.9972
Description NZZ/SPL family protein
Gene Model
Gene Model ID Type Source Coding Sequence
mrna27169.1-v1.0-hybridgenomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NOZZLE21.44e-0712673894
                   NOZZLE 38 etkksrgrkpgsktaqqkqkkptlrgmgvaklerfiieeekkklvvatvgdtssvaa 94
                              +    gr   sk ++ kqkk   rg+gva+le+ ++ee++kk +      t + a+
  mrna27169.1-v1.0-hybrid 12 SPTGGFGRSSNSKKTN-KQKKVPQRGLGVAQLEKIRLEEQQKKAASVLTSPTPTPAS 67
                             5566679999999875.6677778*****************9986665555554443 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF087448.2E-51660IPR014855Plant transcription factor NOZZLE
Sequence ? help Back to Top
Protein Sequence    Length: 445 aa     Download sequence    Send to blast
MGVEEKTQQC TSPTGGFGRS SNSKKTNKQK KVPQRGLGVA QLEKIRLEEQ QKKAASVLTS  60
PTPTPASNSL PSPTKSSPCV PNPAPIRHYQ PPSSISFPSL PSLDLPSPNS IFRPPNAEVV  120
RKQQNSVSAV PLPNNGFEIP GHGNVVVPNF WNPNCEYNGA DLNKESSSGI LDPGFAFRPS  180
LNNLPTFDHS NPIWPLPNFQ RTQQFHHQPQ PQPPPPPPPS LVNVSSATSL SSSSSVLNFH  240
TEPPSNQSYY SNYTTPMWSE EERMVGMKRP YPFSQEIDAP SINFKFPTFV APPMRTDETT  300
SCGNRGGTYN LDPGCNSIFR EGPTCSTSIA ESNSKISIKE NGSVNGDFLT LAPPTSNRAC  360
PSQKFSFPPG YLAFHNPEVP NFASFPYQGS SEDTIFQPGP SGSNPQQAFY TFIPPARAQL  420
VRPAATINNC NGDVGETVDL NLKL*
Cis-element ? help Back to Top
SourceLink
PlantRegMapmrna27169.1-v1.0-hybrid
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011460771.10.0PREDICTED: myb-like protein J
TrEMBLA0A2P6QA730.0A0A2P6QA73_ROSCH; Putative transcription factor NOZZLE family
STRINGEMJ128261e-149(Prunus persica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF89561213