PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID mrna27137.1-v1.0-hybrid
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Rosoideae; Potentilleae; Fragariinae; Fragaria
Family STAT
Protein Properties Length: 1080aa    MW: 120748 Da    PI: 7.5851
Description STAT family protein
Gene Model
Gene Model ID Type Source Coding Sequence
mrna27137.1-v1.0-hybridgenomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
                     STAT   1 ldvvllnalgqpvekdvevvasLlyadsglvveksddaeapLLisydGvefssedrplkllrGrasfklkisqLsskcdnrLfrik 86 
                              ldvvll+a++++++k++ev+asL y d+g++v+k++d e+pLL+  dG+ef+s drp+k+++GrasfklkisqLsskcdnrLfri 
                              8************************************************************************************* PP

                     STAT  87 feipklkkypfleavskpirCisrsrntrsss 118
                              f+ip+ ++ypfl+a++ pirC+s s+n+  ss
  mrna27137.1-v1.0-hybrid 363 FQIPNWENYPFLKAFTPPIRCVSPSHNAVVSS 394
                              *************************9987665 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF498992.88E-1066225IPR013320Concanavalin A-like lectin/glucanase domain
Gene3DG3DSA: A-like lectin/glucanase domain
Gene3DG3DSA:3.30.505.105.9E-7633705IPR000980SH2 domain
SuperFamilySSF555501.21E-7635731IPR000980SH2 domain
PROSITE profilePS500019.485641734IPR000980SH2 domain
Gene3DG3DSA: hitNo description
SuperFamilySSF561129.85E-767921072IPR011009Protein kinase-like domain
PROSITE profilePS5001140.1748001079IPR000719Protein kinase domain
SMARTSM002204.7E-348001079IPR000719Protein kinase domain
PfamPF000691.2E-478021068IPR000719Protein kinase domain
PROSITE patternPS001070806828IPR017441Protein kinase, ATP binding site
Gene3DG3DSA:1.10.510.101.2E-458781071No hitNo description
PROSITE patternPS001080922934IPR008271Serine/threonine-protein kinase, active site
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006468Biological Processprotein phosphorylation
GO:0004672Molecular Functionprotein kinase activity
GO:0005524Molecular FunctionATP binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0007010developmental stagewhole plant fruit ripening stage
PO:0007027developmental stagewhole plant fruit formation stage 70% to final size
Sequence ? help Back to Top
Protein Sequence    Length: 1080 aa     Download sequence    Send to blast
3D Structure ? help Back to Top
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4oh4_A4e-75778107516321Protein BRASSINOSTEROID INSENSITIVE 1
4oh4_B4e-75778107516321Protein BRASSINOSTEROID INSENSITIVE 1
Search in ModeBase
Cis-element ? help Back to Top
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004295681.10.0PREDICTED: uncharacterized protein LOC101298500
TrEMBLA0A2Z7B6I80.0A0A2Z7B6I8_9LAMI; Uncharacterized protein (Fragment)
STRINGXP_004295681.10.0(Fragaria vesca)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G78540.10.0SH2 domain protein B