PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | mrna26806.1-v1.0-hybrid | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Rosoideae; Potentilleae; Fragariinae; Fragaria
|
||||||||
Family | LBD | ||||||||
Protein Properties | Length: 147aa MW: 16328.3 Da PI: 4.9002 | ||||||||
Description | LBD family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | DUF260 | 130.5 | 7.4e-41 | 5 | 104 | 1 | 100 |
DUF260 1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqq 86 +CaaC++lrr+C++dC++apyfp ++p++fa vh+++Gasnv ++l++lp++ r +a+++l+yeAe+r+++PvyG+vgv+++l++q mrna26806.1-v1.0-hybrid 5 RCAACRYLRRRCPSDCIFAPYFPPNNPQRFASVHRIYGASNVARMLQQLPPDLRAQAADTLYYEAECRVENPVYGCVGVLSRLHEQ 90 6************************************************************************************* PP DUF260 87 leqlkaelallkee 100 +e++++ela+++++ mrna26806.1-v1.0-hybrid 91 IEEAESELAKTRAN 104 *********99876 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS50891 | 25.501 | 4 | 105 | IPR004883 | Lateral organ boundaries, LOB |
Pfam | PF03195 | 6.0E-41 | 5 | 102 | IPR004883 | Lateral organ boundaries, LOB |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0016020 | Cellular Component | membrane |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 147 aa Download sequence Send to blast |
MISGRCAACR YLRRRCPSDC IFAPYFPPNN PQRFASVHRI YGASNVARML QQLPPDLRAQ 60 AADTLYYEAE CRVENPVYGC VGVLSRLHEQ IEEAESELAK TRANIVLNSD VGQQSQVQQI 120 DDEVEDNSSL LQAQTIVGQT QFGSSF* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
5ly0_A | 2e-36 | 6 | 98 | 12 | 104 | LOB family transfactor Ramosa2.1 |
5ly0_B | 2e-36 | 6 | 98 | 12 | 104 | LOB family transfactor Ramosa2.1 |
Search in ModeBase |
Binding Motif ? help Back to Top | |||
---|---|---|---|
Motif ID | Method | Source | Motif file |
MP00381 | DAP | Transfer from AT3G26620 | Download |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | mrna26806.1-v1.0-hybrid |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | Retrieve |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_004308220.1 | 1e-105 | PREDICTED: LOB domain-containing protein 24-like | ||||
Swissprot | P59468 | 6e-50 | LBD24_ARATH; LOB domain-containing protein 24 | ||||
TrEMBL | A0A2P6S7J3 | 8e-82 | A0A2P6S7J3_ROSCH; Putative transcription factor AS2-LOB family | ||||
STRING | XP_004308220.1 | 1e-104 | (Fragaria vesca) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF3697 | 30 | 66 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT3G26660.1 | 2e-42 | LOB domain-containing protein 24 |
Link Out ? help Back to Top | |
---|---|
Phytozome | mrna26806.1-v1.0-hybrid |